DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn88Eb and serpini1

Sequence 1:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001122164.1 Gene:serpini1 ZFINID:ZDB-GENE-060503-390 Length:415 Species:Danio rerio

Alignment Length:446 Identity:114/447 (26%)
Similarity:206/447 (46%) Gaps:73/447 (16%)


  Fly     6 LVLLALLPVVTI------AALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFS 64
            ::||.:||.:.:      .|.|.||           ....:||:.|..|::......|:.|||.|
Zfish     1 MLLLVVLPPLLLLRGCFCQASDVPE-----------DVTAEFSVRLYHQLQISSGEENIIFSPLS 54

  Fly    65 TYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFR-WRQSPMELSS----- 123
            ...||.:....:...:.:|:.||             |.|:..:..:||. .|.....||:     
Zfish    55 VALALGMVELGARGSSLQEIRQA-------------VGYSHFREDEEFSLLRNLSQALSTDEEQY 106

  Fly   124 ----ANRIFVDRTINVSNKFNTLL---YGATKE-LDFKNDPETGLKE-INDWIADKTHNQIRDML 179
                ||.:|:...::.:..|..|:   :.|..| :||..  .|.:.| ||.|:.:.|.::|::::
Zfish   107 VVRLANSLFLQSGVHFNEDFLQLMKKYFRAEVETVDFSQ--STAVAERINSWVLNHTESKIQNLV 169

  Fly   180 SSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKM------T 238
            |:|:.:..||::|.||.|.:|.|.:||:.|.|....|..::..:....||::.|.|..      |
Zfish   170 SAEDFSSSTMIMLVNAVYFRGSWKNQFRPENTRTFSFTRDDGSEVQTLMMYQQGDFYYGEFSDGT 234

  Fly   239 IDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFE 303
            .:.|...|::::.|               ...|:||:|:||. .::.|..:...:.|..:::|..
Zfish   235 TEAGGVYQVLEMLY---------------EGEDMSMMIVLPR-QEVPLASLEPIIKAPLLEEWAN 283

  Fly   304 RALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTA---DPISLVIDDAQHLAKI 365
            ....||:|:.||:|:.||:::|...|..:|:.::|:::|....:||   |...|.|..|...|.:
Zfish   284 NVKRQKVEVYLPRFKVEQKIDLRESLQQLGIRSIFSKDADLSAMTAQMTDGQDLFIGKAVQKAYL 348

  Fly   366 KVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            :|.|.|:..||.:.::....:....| :...:|||.|:|.:.|..:|||.|...:|
Zfish   349 EVTEEGAEGAAGSGMIALTRTLVLYP-QVMADHPFFFIIRNRKTGSILFMGRVMNP 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 105/405 (26%)
serpini1NP_001122164.1 SERPIN 25..414 CDD:294093 107/423 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126693
Panther 1 1.100 O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.