DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn88Eb and Serpina7

Sequence 1:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_006528640.1 Gene:Serpina7 MGIID:3041197 Length:464 Species:Mus musculus

Alignment Length:403 Identity:91/404 (23%)
Similarity:175/404 (43%) Gaps:59/404 (15%)


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104
            ||:.:|.:::....|..|:||||.|...||.:..|.|...|:.::.:.|...        |....
Mouse    97 DFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFN--------LTDTP 153

  Fly   105 LAQRQDEFR-------WRQSPMELSSANRIFVDRTINVSNKF----NTLLYGATKELDFKNDPET 158
            :.:.|..|:       :.::.:||...|.:|:.:.:....||    .||........||.| ...
Mouse   154 VTELQQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSN-VSA 217

  Fly   159 GLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEET-ALKPFFINERE 222
            ...:||.::..:|..:|..::...::  :.:::|.|..:.:.||.:.|:|.:| ....|.:::..
Mouse   218 AQHKINSYVEKQTKGKIVGLIQGLKL--NIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKST 280

  Fly   223 QEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLN 287
            ...|.|||:...:...:|..|...::::.|               |::.:: :.:||...  .:.
Mouse   281 TVQVPMMHQLEQYYHYVDMELNCTVLQMDY---------------SENALA-LFVLPKEG--HME 327

  Fly   288 RVISRLNADSVKKWFERALPQK--IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTAD 350
            .|.:.:::.::|||  ..|.||  :||.:|||......:|...|..||:...|..:|.|..:|.|
Mouse   328 WVEAAMSSKTLKKW--NYLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITED 390

  Fly   351 PISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHP-------FVFLIYDEK 408
            . .|.:..|.|.|.:.:.|.| |...|:..:.|...::..|.     ||       |:.:|.:::
Mouse   391 S-GLKLSYAFHKAVLHIGEEG-TKEGASPEVGSLDQQEVPPL-----HPVIRLDRAFLLMILEKR 448

  Fly   409 VDTILFAGVYSDP 421
            ..::||.|...:|
Mouse   449 TRSVLFLGKLVNP 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 90/399 (23%)
Serpina7XP_006528640.1 alpha-1-antitrypsin_like 95..457 CDD:239011 90/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.