DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn88Eb and srp-2

Sequence 1:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_503318.1 Gene:srp-2 WormBaseID:WBGene00005643 Length:359 Species:Caenorhabditis elegans

Alignment Length:394 Identity:99/395 (25%)
Similarity:178/395 (45%) Gaps:54/395 (14%)


  Fly    38 ERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVS 102
            :.||:|.|:..:..   ||::..||.|....|.|.:..:...|::||..      .|...::...
 Worm     8 QTDFALKLLATLPH---SGSVVLSPLSISLGLALIHAGACGSTQKELED------VLGGSRIFEE 63

  Fly   103 YT-LAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF-NTL--LYGATKE-LDFKNDPETGLKE 162
            :: |.:...:   ..:.:|....||:||::...:...: .|:  ||.|:.| ||| :..|...|.
 Worm    64 FSGLMEAVGD---TDNGVETKIVNRVFVNQAYTIHQDYLETVEKLYKASGESLDF-SQTEQAAKT 124

  Fly   163 INDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVY 227
            :|.::.:.|:.:|:|::.::... :....|.||.|.|..|.|:|..|.|..:.||.:|.|...: 
 Worm   125 MNTFVENHTNGKIKDLIPADSAN-NAFAFLVNAMYFKADWQSKFAKESTTGREFFTSEAESRQI- 187

  Fly   228 MMHKTGAFKMTID------EGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISL 286
                  .|...:|      |.:..|::.|.|           :.|:    .::.|.|| ..:..|
 Worm   188 ------PFLTELDEHRDYTEDVLFQVLSLKY-----------ADPK----FTLAIFLP-KQRFGL 230

  Fly   287 NRVISRLNADSVKKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADP 351
            ...:.::|.:.::..........:.:.:|||:.|:.|:|...|..:|:..:|...|   ||:...
 Worm   231 VDALEKINGEYIQNLLNDLKSSYVSVQIPKFKIEKELDLKETLEAIGIKEIFAEGA---DLSGIA 292

  Fly   352 ISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSR-QPDPTKFNCNHPFVFLIYDEKVDTILFA 415
            ..:.|....|.|.|:|||.|:|||||:...|..... ..:||:|..:|||:|.:..|  :..||.
 Worm   293 DKVFISSGIHKAIIEVDEDGTTAAAASAFKVQLEMMIMAEPTQFVADHPFLFAVLFE--NHTLFL 355

  Fly   416 GVYS 419
            ||::
 Worm   356 GVHA 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 99/392 (25%)
srp-2NP_503318.1 SERPIN 7..358 CDD:238101 99/392 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126693
Panther 1 1.100 O PTHR11461
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.