DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and EFHD2

DIOPT Version :8

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_077305.2 Gene:EFHD2 / 79180 HGNCID:28670 Length:240 Species:Homo sapiens

Alignment Length:169 Identity:60/170 (35%)
Similarity:80/170 (47%) Gaps:27/170 (16%)


  Fly   201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHA 265
            |::|:|......|.|.|...||:|.|.|||..:|||..|||||..||::..|..:...:|:|...
Human    89 FSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREF 153

  Fly   266 LLIYGTVLNRLELRK---GHLLDRERL-RLARSKAVDVSKVGVSGAKQFFEAKIAMQSDPLPPIN 326
            |||:         ||   |.|.:...| .|||...:|||..||.|||.|||||:       ..||
Human   154 LLIF---------RKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKV-------QAIN 202

  Fly   327 SDQPVARIAVHSLNTENPGRR---VNFKSAAALFKKLEN 362
                |:......:..|...|:   ...|...|.||:|::
Human   203 ----VSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQS 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
EFHD2NP_077305.2 EFh 96..154 CDD:238008 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280445785
eggNOG 1 0.900 E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3918
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13025
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.