DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and efhd1

DIOPT Version :8

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_989300.1 Gene:efhd1 / 394919 XenbaseID:XB-GENE-5738953 Length:236 Species:Xenopus tropicalis

Alignment Length:165 Identity:55/166 (33%)
Similarity:75/166 (45%) Gaps:18/166 (11%)


  Fly   201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHA 265
            |::|:|....:.|.:.|...||:|.:.|||..:|||..|||||..||::..|..:...:|.|...
 Frog    84 FSRKQIKDMEAMFKKYDSGKDGFIDMMELKFLMEKLGAPQTHLGLKNMIKEVDEDFDNKLNFREF 148

  Fly   266 LLIY-GTVLNRLELRKGHLLDRERLRLARSKAVDVSKVGVSGAKQFFEAKIAMQSDPLPPINSDQ 329
            |||: ......||...|      .|.||:...:||...||.|||.|||||:...|      :|.:
 Frog   149 LLIFHKAAAGELEEDSG------LLALAKLSEIDVDVEGVKGAKNFFEAKVQALS------SSSK 201

  Fly   330 PVARIAVHS-----LNTENPGRRVNFKSAAALFKK 359
            ..|.|....     ...|...||..||...:.|.:
 Frog   202 FEAEIRAEQEERKRQEEEKKNRRAAFKELKSAFNQ 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
efhd1NP_989300.1 EFh 91..149 CDD:238008 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280446515
eggNOG 1 0.900 E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.