DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and Swip-1

DIOPT Version :8

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster

Alignment Length:165 Identity:58/166 (35%)
Similarity:81/166 (49%) Gaps:20/166 (12%)


  Fly   201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHA 265
            |::.:|......|...|...||::.|.|||..:|||..|||||..|.::..|..::..:::|...
  Fly    66 FSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREF 130

  Fly   266 LLIYGTVLNRLELRKGHL-LDRERLRLARSKAVDVSKVGVSGAKQFFEAKIAMQ------SDPLP 323
            |||:      .:.:.|.| .|....:|||...|||.:|||||||.||||||..|      .|   
  Fly   131 LLIF------RKAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHD--- 186

  Fly   324 PINSDQPVARIAVHSLNTENPGRRVNFKSAAALFK 358
            .|.::|...|    ....|...||..|:..||:|:
  Fly   187 EIRAEQEERR----REEEERAQRRQQFQQRAAIFQ 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 19/58 (33%)
EF-hand_7 75..131 CDD:290234 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280413327
eggNOG 1 0.900 E1_KOG0041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3918
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13025
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.