DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and efhd1

DIOPT Version :8

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001292523.1 Gene:efhd1 / 335521 ZFINID:ZDB-GENE-030131-7461 Length:227 Species:Danio rerio

Alignment Length:205 Identity:61/206 (30%)
Similarity:96/206 (47%) Gaps:31/206 (15%)


  Fly   174 PLTVTSEDSDCDYELSLD---EVH---------QRFSAW-----FNQKEIDTAYSCFTQMDEDLD 221
            |.|..|:|:..:....|:   ::|         :.|:.:     |::|:|....:.|.:.|...|
Zfish    31 PATTMSDDTTSELTEKLNRRLDIHDGTAKPKQMKVFNPYTEFKEFSRKQIKDMETMFKRFDSGKD 95

  Fly   222 GYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHALLIYGTVLNRLELRKGHLLDR 286
            |:|.|.|||..:|||..|||||..||::..|..::..:|::...|||:      .....|.|.:.
Zfish    96 GFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDYDGKLSYREFLLIF------RRAAAGELQEE 154

  Fly   287 ERL-RLARSKAVDVSKVGVSGAKQFFEAK---IAMQSDPLPPINSDQPVARIAVHSLNTENPGRR 347
            ..| .|||...:|||..||.||:.|||||   ::::|.....:..:|...:    .|..|...||
Zfish   155 SGLMALARLSEIDVSTEGVLGARDFFEAKAQALSVRSKFEAELREEQEERK----RLELERKQRR 215

  Fly   348 VNFKSAAALF 357
            ..||...:.|
Zfish   216 AAFKELQSTF 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
efhd1NP_001292523.1 EF-hand_7 83..140 CDD:290234 21/57 (37%)
EFh 86..140 CDD:238008 21/54 (39%)
EF-hand_7 119..182 CDD:290234 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280452156
eggNOG 1 0.900 E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13025
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.