DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdr and drl

DIOPT Version :9

Sequence 1:NP_001287331.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001260566.1 Gene:drl / 44355 FlyBaseID:FBgn0015380 Length:645 Species:Drosophila melanogaster


Alignment Length:191 Identity:41/191 - (21%)
Similarity:65/191 - (34%) Gaps:56/191 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 SRNHDYRRKEFEKVINYEHLLSIKKDEEPT---RPPTTTPAPTNATLAKERLAAINYENYRLNSE 764
            |:.|........|..:::.|.:|......:   .|.|.|  ||.|||.:.      :..|....|
  Fly   271 SKRHPSNGVHLIKTSSFQRLPTISSTAHNSIYVCPSTIT--PTYATLTRP------FREYEHEPE 327

  Fly   765 KKQRDLQDLDQHKYTIR----------------------HALPKCQNSHASVVQQVEEKCVAEEP 807
            :..|.||:|...|..:|                      ..|.|....|||   |::...:.:|.
  Fly   328 EFNRRLQELTVQKCRVRLSCLVQEGNFGRIYRGTYNDCQEVLVKTVAQHAS---QLQVNLLLQES 389

  Fly   808 LSGYELPGTQHFYCLSQLEPETHYRITIRACVEGV-VNGCSTPAEAVIKTASIQ-LERFIK 866
            :..||   ..|...||.|               |: :...:||......|.|:: |:.|::
  Fly   390 MMLYE---ASHPNVLSVL---------------GISIEDYATPFVLYAATGSVRNLKSFLQ 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382
FN3 491..578 CDD:214495
drlNP_001260566.1 WIF 21..157 CDD:128745
PTK_Ryk 336..606 CDD:270639 23/118 (19%)
Pkinase_Tyr 343..599 CDD:285015 21/111 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.