DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and Cad96Ca

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_651349.1 Gene:Cad96Ca FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster

Alignment Length:309 Identity:57/310 (18%)
Similarity:95/310 (31%) Gaps:92/310 (30%)


  Fly   555 SRRHVISGLKPYTQYAYFVKTLTRTEYHIQIDAYSKIGYFQTLPDRPSPVLRIYGSSEISSQILL 619
            |...|:..|:|:....:.:...|..:....|..|...|..||.. |.|...|.||::...|.:| 
  Fly   520 SELEVMKSLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYL-RSSRAERHYGNTHGKSNVL- 582

  Fly   620 HWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELENAKDIDCECAGVLPYYSGPQPDDEDY 684
                        .:..:|:..|...|                       |:            ||
  Fly   583 ------------TSCDLTSFMYQVAK-----------------------GM------------DY 600

  Fly   685 YNKEQITYEDALPNLIYVSRNHD-----------------YRRKEFEKV--------INYEHLLS 724
            .....|.:.|.....|.::.:|.                 |.||...|:        ..|:::.|
  Fly   601 LTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPIRWMATESLYDNIFS 665

  Fly   725 IKKD---------EEPTRPPTTTPAPTNA-TLAKERLAAINYENYRLNSEKKQRDLQDLDQHKYT 779
            :|.|         |..|...|..|..:.| .:.|.|      :.|||  ||.:...::|....|.
  Fly   666 VKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVR------DGYRL--EKPEHCRRELYNIMYY 722

  Fly   780 IRHALPKCQNSHASVVQQVEEKCVAEEPLSGYELPGTQHFYCLSQLEPE 828
            .....|:.:...|.::|.:::....|......|.....::|.:..|..|
  Fly   723 CWSHDPQERPLFAEIIQMLDKLLHTEMDYIELERFPDHNYYNIVSLSGE 771

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382
FN3 491..578 CDD:214495 5/23 (22%)
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 52/278 (19%)
PTKc 474..742 CDD:270623 52/279 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102048447
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.