DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and INSRR

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_055030.1 Gene:INSRR HGNCID:6093 Length:1297 Species:Homo sapiens

Alignment Length:904 Identity:261/905 (29%)
Similarity:410/905 (45%) Gaps:163/905 (18%)


  Fly    14 PISIAVPLILLFLGASSPVLASSDDQTACGSLEI-NKIADLRKLQNCTHVVGHVRLAYV------ 71
            |....:|:|.|.||      ...|....|.||:| :::|:||:|:||:.|.||:::..:      
Human     8 PWGACLPVIFLSLG------FGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLMFTATGE 66

  Fly    72 DLTDVSGNYSLDSLASNVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRN 136
            |...:|        ...:|:::|||:::|..||.||:.:||.|.:|||.. ||..|:||::|..:
Human    67 DFRGLS--------FPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTR-LFLGYALVIFEMPH 122

  Fly   137 LRELGLVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFSLKHNRPQSQC-PLC-GSLS 199
            ||::.|..|..:..|.:|||.|..||.:.|:||..|.......|  :..|:...:| .:| |.|.
Human   123 LRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANH--IVGNKLGEECADVCPGVLG 185

  Fly   200 ADFE------FIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCDSAGKCCDHNCVTGCYS-- 256
            |..|      |..::..|||..:..|        :.||...|: .|.:.|:||...|:.||..  
Human   186 AAGEPCAKTTFSGHTDYRCWTSSHCQ--------RVCPCPHGM-ACTARGECCHTECLGGCSQPE 241

  Fly   257 --QNCSLCANYQGRMGCVNQC-VASYELNKRRCIGHRECRELGRIP-------LIRGYQCVKKCP 311
              :.|..|.:...:..|:..| ..:|:....||:....|..|..:|       :.:| .|:.:||
Human   242 DPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQG-SCLAQCP 305

  Fly   312 G----NQKEILVAKGIIHCQVECNGDFHVKSAADLEVLQD---CVTINGSLTIELT---NIKEKI 366
            .    |...|...|....|..||.  ...|:...::..||   |..:.|||.:.|.   |::.: 
Human   306 SGFTRNSSSIFCHKCEGLCPKECK--VGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQ- 367

  Fly   367 VDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENKYALYVVNNYHLEHI--WP 429
               |:::|..|:.|||:||:.||..|:||.|.:||..||||.:|:..|.|||::|.:|:.:  |.
Human   368 ---LQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQNLQQLGSWV 429

  Fly   430 PNHLVIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGERVICGDAVRSLNPKV 494
            ...|. |..|.::|..|||||.|.|::|:....:....:.|:::|.:||:|..|..........|
Human   430 AAGLT-IPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRAACQTRTLRFVSNV 493

  Fly   495 EDLNSTAVRIILDYMDWEGMET--LIGYSYHYKEAPVQNVTMYDGRHGCGHDNW-LMDVVPNQSR 556
            .:    |.||:|.:..:|.:|.  |:.:..:|||:|.||.|.:.|...||..:| |:||....||
Human   494 TE----ADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSR 554

  Fly   557 RH----VISGLKPYTQYAYFVK--TLTRTEYHIQIDAYSKIGYFQTLPDRPSPVLRIYGSSEISS 615
            ..    .::.|||:||||.||:  |||..|......|.|.|.|.:|||..|:....:..:|..||
Human   555 TQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSS 619

  Fly   616 QILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKN-YVNVELENAKDIDCECAGVLPYYSG-PQ 678
            .:|:.|.||.:.||.:..|.|..::.     |:|.: |:|       |. |.....||..:. |:
Human   620 HLLVRWKPPTQRNGNLTYYLVLWQRL-----AEDGDLYLN-------DY-CHRGLRLPTSNNDPR 671

  Fly   679 PDDEDYYNKEQITYE----------DALPNLIYVSRNHDYRRKEFEKVINYEHLLSIKKDEEPTR 733
            .|.||...:.::..:          ..||.|       :.:...|:|  .:|:.|         .
Human   672 FDGEDGDPEAEMESDCCPCQHPPPGQVLPPL-------EAQEASFQK--KFENFL---------H 718

  Fly   734 PPTTTPAPTNATLAKERLAAINYENYRLNSEKKQRDLQDLDQHKYTIRHALPKCQNSHASVVQQV 798
            ...|.|      ::..::.:||        :..||   |..:|:   |.|.|.....::|..:..
Human   719 NAITIP------ISPWKVTSIN--------KSPQR---DSGRHR---RAAGPLRLGGNSSDFEIQ 763

  Fly   799 EEKCVAEEPLSGYELPGTQHFYCLSQLEPETHYRITIRACVEGV-VNGCSTPAEAVIKT 856
            |:|...|..:    |.|.:||         |.|||.|.||.... ..|||.......:|
Human   764 EDKVPRERAV----LSGLRHF---------TEYRIDIHACNHAAHTVGCSAATFVFART 809

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 43/121 (36%)
Furin-like 209..332 CDD:279142 34/139 (24%)
Recep_L_domain 347..461 CDD:279382 47/122 (39%)
FN3 491..578 CDD:214495 36/96 (38%)
INSRRNP_055030.1 Recep_L_domain 47..158 CDD:279382 42/120 (35%)
Furin-like 173..326 CDD:279142 39/163 (24%)
FU 228..275 CDD:238021 12/47 (26%)
Recep_L_domain 346..460 CDD:279382 46/119 (39%)
FN3 490..600 CDD:238020 41/114 (36%)
FN3 605..>649 CDD:238020 14/49 (29%)
FN3 819..908 CDD:238020
PTKc_InsR_like 972..1248 CDD:173625
Pkinase_Tyr 979..1246 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120934at33208
OrthoFinder 1 1.000 FOG0000777
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.