DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and Nrk

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_477255.1 Gene:Nrk FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster

Alignment Length:814 Identity:145/815 (18%)
Similarity:247/815 (30%) Gaps:251/815 (31%)


  Fly   115 RIIRGQELLFDQYSLVVYENRNLRELGLVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQ 179
            |::||         :|:....||..|||...|...:    ..:|.|....|.|         ||:
  Fly    12 RVLRG---------MVLKWGANLAVLGLCVFLFASA----THANSLNAIEEPV---------TRR 54

  Fly   180 HFSLKHNRPQSQCPLCGSLSADFEFIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCDSAGK 244
            |....|.|.:.:...|...         |.:.|....|.|            :...|.  |..|.
  Fly    55 HHQRHHEREREENGYCAPY---------SGKVCKEYLTGQ------------VWYSLE--DPTGG 96

  Fly   245 CCDHNCVTGCYSQNCS----LCANYQGRMGCVNQCVASYELNKRRCIGHRECRELGRIPLIRGYQ 305
            ..:....|..:.:..|    ||.....:|.|      :|..  ..|  |.|.....:.||     
  Fly    97 WKNEQVTTALWDELISDLTGLCREAAEKMLC------AYAF--PNC--HMEGGRAVKAPL----- 146

  Fly   306 CVKKCPG-------NQKEILVAKGIIHCQVECNGDFHVKSAADL--------------------- 342
            |.:.|..       |...::..|...:..::..|.|.:.:.:.|                     
  Fly   147 CFEDCQATHLQFCYNDWVLIEEKKERNMFIKSRGHFRLPNCSSLPHYNASMRRPNCSYIGLTELK 211

  Fly   343 --EVLQDCVTINGSLTIELTNIKEKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIR 405
              ||..||...||...:...|:.       ::.:...:..|.|   .|......|.|.|.|:   
  Fly   212 ESEVSYDCRNGNGRFYMGTMNVS-------KSGIPCQRWDTQY---PHKHFQPPLVFHQLLE--- 263

  Fly   406 GDKLVENK---------YAL----------------YVVNN-------YHLEHIWPPNHLVIIQR 438
            |:....|.         |.:                ||..|       ..:|..:.|: ::.:..
  Fly   264 GENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMCPDYVDPNAVDLNTPIKMEKFFTPS-MIFLLA 327

  Fly   439 GTLF-----FHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGERVICGDAVRSLNPKVEDL- 497
            |..|     .||...|.|:.......|..:|...:...||....|:   ||.   :||...|.| 
  Fly   328 GIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAECSVSMRGGGD---CGG---NLNTSRETLG 386

  Fly   498 ----------------------NSTAVRIILDYMDWEG------METLIGYSYHYKEAPVQNV-T 533
                                  |..|:..:.:..|.:|      :|.|     .|....:..| :
  Fly   387 GNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKGTKPNARLEKL-----EYPRGDIVYVRS 446

  Fly   534 MYDGRHGCGHDNWLMDVVPNQSRRHVISGLKPYTQYAYFVKTL-TRTEYHIQIDAYSKIGYFQTL 597
            :..|..|.........:||:|....|.            ||.| ......:|:| :.:.......
  Fly   447 LGQGAFGRVFQARAPGLVPDQEDLLVA------------VKMLKDDASDQMQMD-FEREACLLAE 498

  Fly   598 PDRPSPVLRIYGSSEISSQ--ILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVE---- 656
            .|.|: ::|:.|...:...  :|..:..|    |.:..:......| ||.:|..::.:.:.    
  Fly   499 FDHPN-IVRLLGVCALGRPMCLLFEYMAP----GDLSEFLRACSPY-ATHQAPTQDRLQLNELHL 557

  Fly   657 LENAKDIDCECAGVLPYYSGPQPDDEDYYNKEQITYEDALPNLIYVSRNHDYRRKEF---EKVIN 718
            |:.|.:|   .||:|            |.::.:..:.|.......::.:...:..:|   .|:..
  Fly   558 LQMAANI---AAGML------------YLSERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYL 607

  Fly   719 YEHLLSIKKDEEPTRPPTTTPAPTNATLAKERLAAINYENYRLNSEKKQRDLQDLDQHKYTIRHA 783
            .::   .|.||....|....|           |.:|.|..:.|.|:.....:...:...:.::  
  Fly   608 QDY---YKGDENDFIPIRWMP-----------LESILYNKFSLESDVWAYGICLWEVFSFALQ-- 656

  Fly   784 LPKCQNSHASVVQQVEE----KCVAEEPLSGYEL 813
             |....:|..|::.::|    .|....|||.|.|
  Fly   657 -PYFGLTHEEVIKYIKEGNVLGCPDNTPLSVYAL 689

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 14/58 (24%)
Furin-like 209..332 CDD:279142 22/134 (16%)
Recep_L_domain 347..461 CDD:279382 27/151 (18%)
FN3 491..578 CDD:214495 20/118 (17%)
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308 27/183 (15%)
KR 217..299 CDD:214527 15/95 (16%)
PTKc_Musk 435..713 CDD:133181 54/307 (18%)
Pkinase_Tyr 441..707 CDD:285015 53/301 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102047216
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.