DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and dnt

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001260567.1 Gene:dnt FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster

Alignment Length:298 Identity:58/299 (19%)
Similarity:96/299 (32%) Gaps:81/299 (27%)


  Fly   605 LRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNY-----VNVELENAKDID 664
            |:::..||:::.:.:.    ..|..|::...|:||.| ..:|....||     |.|. .|.|||.
  Fly    35 LQLHSGSEVAAHLNVF----LNPVEVMRLLGVSAEVY-YVREGHINNYALNFIVPVP-ANVKDIS 93

  Fly   665 CECAGV----LPYYSGPQPDDEDYYNKE--QITYEDALPNLI----YVSRNHDYRRKEFEKVINY 719
            .....:    |||.......|::...:.  .:::...:|..|    ...:....:..|.:..::.
  Fly    94 FTWQSLAGRGLPYSINVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSL 158

  Fly   720 E-----------HLLSIKKD---------------------EEPTRPPT---TTPAPTNATLAKE 749
            |           ||:..:|.                     |....|||   |.....:..:...
  Fly   159 EVVLNRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQLLETVMLPPTGLITLVVGVSVAMGSV 223

  Fly   750 RL---------AAINYENYRLNSEKKQR--DLQDLDQHKYTIRHALPKCQNSHASVVQQVEEKCV 803
            .|         .|.|...:..:..:..|  ..|.|:.|        |.||:|..|.. .:....:
  Fly   224 CLLLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTH--------PPCQSSMGSAA-YMTPSII 279

  Fly   804 AEEPLSGYELPGTQHFYCLSQLEPETHYRI---TIRAC 838
            |  |:.|..||.........|...|.|.||   |:..|
  Fly   280 A--PIHGSSLPRKVPVSVEQQHPEELHRRISELTVERC 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382
FN3 491..578 CDD:214495
dntNP_001260567.1 WIF 46..182 CDD:128745 26/142 (18%)
PKc_like 310..580 CDD:304357 2/7 (29%)
Pkinase_Tyr 317..573 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102049986
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.