DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and CG3277

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_608762.3 Gene:CG3277 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster

Alignment Length:804 Identity:143/805 (18%)
Similarity:275/805 (34%) Gaps:258/805 (32%)


  Fly    13 IPISIAVPLILLFL----------GASSPVLASSDDQTACGSLEINKIADLRKLQNCTHVVG-HV 66
            :|..|.:.|:|:.:          .|::|.|.         ||..:...:..::::..:|.| ..
  Fly     7 VPSRIVLILLLVLVRNAVGQAPRENATNPTLI---------SLVRSSEKEPEQMESHRYVTGLSE 62

  Fly    67 RLAYVDLTDVSGNYSLDSLASNVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELL--FDQYSL 129
            .:|...||.:..|.:.|   ..:||::..:.:|       ::.| |||: :|.|:.|  ...|::
  Fly    63 PIAMEPLTRMRLNPNPD---GEITELTTNVTLY-------MEKI-PRLQ-VRWQDNLPQGTSYNV 115

  Fly   130 VVYENRNLR-------ELGLVEL-LRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFSLKHN 186
            :|....|.|       |.|:.|. ...::..:.:..||.| .||:||..|:.|            
  Fly   116 LVSAVNNSRCPDAPCSEYGIKEKNASAETHSVNLPVNPNL-NVESVDCNYMFG------------ 167

  Fly   187 RPQSQCPLCGSLSADFEFIRNSSE---------RCWNVNTTQLRPQPPRLKDCPIACGLNGCDSA 242
                 |.....:......:|.|:.         :|    :.||.|.||::.            :.
  Fly   168 -----CQYQVIVETSNAMVRRSARVYIPQCLEGKC----SCQLAPTPPKVL------------AV 211

  Fly   243 GKCCDHNCVTGCYSQNCSLCANYQGRM---GCVNQCVASYELNKR------------RCIGHREC 292
            .|...:..:    |.|.|:.|:...|.   ..:::.:.:|::..:            ..:.|...
  Fly   212 AKMLSNETI----SINLSILASELLRKEQDSHLHETLRTYKMQLKINEETNPSLPWGGVLKHLMT 272

  Fly   293 R-----ELGRIPLIRGYQCVKKCP-GNQ---KEILVAKGIIHCQVECNGDFHVKSA---ADLEVL 345
            |     ||......:|::.|.|.. |.|   |..|..:.:|.....|.|...|...   |:..:|
  Fly   273 RVYKLSELNFRATPKGFEGVMKLGLGTQLKEKASLSLQAVIIDPTGCEGPRSVTKVPVPANPVLL 337

  Fly   346 QDCVTINGSLTIELTNIKEKIVDALENALASVKEITGYLKVIHSAQLMSLTFL-------QNLDA 403
            .:..:::.|:.:....:...|:..|...|...:......|:....|:...||.       .|::.
  Fly   338 TEGDSVSNSIIVMSAMLIAIILAGLIMLLLRRRRARTTAKLRKQEQIYIQTFATSAIEMEDNVNY 402

  Fly   404 IRGDKLVENKYALYVVNNYHLEHIWPPNHLVIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENIS 468
            :  ||.||....|.:.:.:.:.|       ..||.|.:.    ....:.::|:           :
  Fly   403 V--DKYVEKSQVLGLADIFEVPH-------SAIQIGRML----GEGAFGQVHE-----------A 443

  Fly   469 VADVSPNSNGERVICGDAVRSL--NPKVEDLNSTAVRIILDYMDWEGMETLIGYSYHYKEAPVQN 531
            .|.......|..::   ||:.|  |||.::        :.:|:  ..:|.|.|...|:      |
  Fly   444 TAINLRRMRGTTIV---AVKQLKPNPKADE--------VAEYL--AEIEMLKGVGTHH------N 489

  Fly   532 VTMYDGRHGCGHDNWLMDVVPNQSRRHVISGLKPYTQYAYFVKTLTRTEYHIQIDAYSKIGYFQT 596
            |..:   .||      ..:.|            ||         |...||   ::..:.:.|.:|
  Fly   490 VVSF---LGC------CTIKP------------PY---------LMIMEY---VNKGNLLSYLRT 521

  Fly   597 LPDRPSPVLRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELE-NA 660
            :....|. ||...::..|.:.::                   .:.|:|...|.::...:||: ::
  Fly   522 VRKEASK-LRNRNANYTSCRPIM-------------------TRTNSTSSPKSQSVNYIELKASS 566

  Fly   661 KDIDCECAGVLPYYSG---PQP----------DDEDYY-----NKE------------------Q 689
            :.|:........:.:|   |.|          :|||.:     |||                  :
  Fly   567 QTIEMPQEDSTAHMNGIRQPHPSFAETTYTIVEDEDAFEYILDNKELHNFALQIANGMRFLEEQE 631

  Fly   690 ITYEDALPNLIYVSRNHDYRRKEF 713
            ||:.|.....:.:..|...:..:|
  Fly   632 ITHRDLAARNVLIDSNKTLKISDF 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 32/126 (25%)
Furin-like 209..332 CDD:279142 26/156 (17%)
Recep_L_domain 347..461 CDD:279382 19/121 (16%)
FN3 491..578 CDD:214495 16/87 (18%)
CG3277NP_608762.3 STYKc 426..763 CDD:214568 53/318 (17%)
PTKc 430..763 CDD:270623 50/314 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102048879
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.