DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and Ddr

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001014474.3 Gene:Ddr FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster

Alignment Length:40 Identity:14/41 (34%)
Similarity:18/41 (44%) Gaps:1/41 (2%)


  Fly   155 VESNPLLCFVETVDWIYLMGNATRQHFSLK-HNRPQSQCP 193
            :||..:..|..|....:.|||...||..|| .|...:.||
  Fly   112 MESGAIADFQITASSAHDMGNVGPQHARLKIDNNGGAWCP 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 4/18 (22%)
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382
FN3 491..578 CDD:214495
DdrNP_001014474.3 FA58C 106..262 CDD:214572 14/41 (34%)
FA58C 109..261 CDD:238014 14/41 (34%)
PTKc_DDR 753..1040 CDD:270644
TyrKc 759..1038 CDD:197581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102049462
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.