DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and Ros1

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_037006.1 Gene:Ros1 RGDID:3591 Length:2338 Species:Rattus norvegicus

Alignment Length:389 Identity:76/390 (19%)
Similarity:121/390 (31%) Gaps:139/390 (36%)


  Fly   497 LNSTAVRIILDY------MDWEGMETLIG-YSYHYKEAPVQNVTMYDGRHGCGHDNWLMDVVPNQ 554
            ||:|...:||..      :.|.|:.|... |..:|.||...|.:  |.:|.      :::...|.
  Rat  1450 LNATNTSLILKLPPVKTNLTWHGITTPTSTYLVYYMEANRANSS--DRKHN------MLESQENV 1506

  Fly   555 SRRHVISGLKPYTQYA-------YFVKTLTRTEYHIQIDAYSKIGYFQTLPDRPSPVLRIYGSSE 612
            :|   |.||:|::.|.       |:...|.......:|...:|.|.       |..|..|..:..
  Rat  1507 AR---IEGLQPFSTYVIQIAVKNYYSDPLEHLSLGKEIQGKTKSGV-------PGAVCHINATVL 1561

  Fly   613 ISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELENAKDIDCECAGVLPYYSGP 677
            ..:.:|:.|....:|||                   .|..|..:|            |:.|.: |
  Rat  1562 SDTSLLVFWTESHKPNG-------------------PKELVRYQL------------VMSYLA-P 1594

  Fly   678 QPDDEDYYNKEQITYEDALPN------LIYVSRNHDYRRK-----EFEKVINYEHLLSIKKDEEP 731
            .|        |....:|..|:      :..:|....|..|     ..|......|.:|:...:.|
  Rat  1595 IP--------ETPLRQDEFPSARLSLLVTKLSGGQQYVLKILACHSEEMWCTESHPVSVNMFDTP 1651

  Fly   732 TRPPTTTP----------APTNATLAKERLAAINYENYRLNSEKKQRDLQDLDQHKYTIRHALPK 786
            .:|....|          ||:||.|.                    |...:|.:.||        
  Rat  1652 EKPSALVPENTSLLLDWKAPSNANLT--------------------RFWFELQKWKY-------- 1688

  Fly   787 CQNSHASVVQQVEEKCVAEEPLSGYELPGTQHFYC-LSQLEPETHYRITIRACVEGVVNGCSTP 849
                  |....|:..| ::.|:          :.| ::.|:|.|.|.|.:........|..|.|
  Rat  1689 ------SEFYHVKASC-SQGPV----------YVCNIANLQPYTPYNIRVVVVYTTGENSSSIP 1735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382
FN3 491..578 CDD:214495 24/95 (25%)
Ros1NP_037006.1 FN3 111..194 CDD:238020
FN3 211..290 CDD:238020
FN3 567..663 CDD:238020
FN3 1036..1142 CDD:238020
FN3 1448..1526 CDD:214495 22/87 (25%)
FN3 1550..1629 CDD:238020 21/119 (18%)
FN3 1649..1740 CDD:238020 25/133 (19%)
FN3 1745..1838 CDD:238020
PTKc_c-ros 1947..2208 CDD:270640
TyrKc 1947..2207 CDD:197581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.