DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and igf1rb

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_694501.1 Gene:igf1rb ZFINID:ZDB-GENE-020503-2 Length:1380 Species:Danio rerio

Alignment Length:905 Identity:251/906 (28%)
Similarity:415/906 (46%) Gaps:188/906 (21%)


  Fly    42 CG-SLEI-NKIADLRKLQNCTHVVGHVRLAYVDLTDVSGNYSLDSLA-SNVTEISDYLMVYRCTG 103
            || .::| |.|.:.::|:|||.:.|::::..:...:.:......:|: ..:|.|:|||:::|.:|
Zfish    29 CGPGIDIGNDIGNFKRLENCTVIEGYLQILLIGDKNSNNQEVFRTLSFPKLTMITDYLLLFRVSG 93

  Fly   104 LISLQSIFPRLRIIRGQELLFDQYSLVVYENRNLRELGLVELLRIQSGFIRVESNPLLCFVETVD 168
            |.||.::||.|.:|||:.|.:: .:||::|..:|:::||..|..|..|.||:|.||.||::::||
Zfish    94 LESLSTLFPNLAVIRGRNLFYN-CALVIFELTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVD 157

  Fly   169 WIYLMGNATRQHFSLKHNRPQSQC-PLCGSLSADFEFIRNSSERCWNVNTTQLRPQPPRLKDCPI 232
            |..:: :|...:| :..|:...:| .:|..:..|    .:...|||..|..|        |.|  
Zfish   158 WSLIL-DAELNNF-IDGNKQSKECGNVCPGIMED----NSQCTRCWTSNHCQ--------KVC-- 206

  Fly   233 ACGLNGCDSAGKCCDHNCVTGC----YSQNCSLCANYQGRMGCVNQC-VASYELNKRRCIGHREC 292
            .||...|..:|:||...|:..|    ..:.|:.|.||.....||..| ..:|:....|||....|
Zfish   207 RCGQRACTDSGQCCHPQCLGSCSVPDSDRACAACQNYNHEGRCVEDCPPGTYKFEGWRCITRDFC 271

  Fly   293 RELGRIP-----LIRGYQCVKKC-PGNQKE----ILVAKGIIHCQVECNG--DFHVKSAAD-LEV 344
            .:: .:|     :|...:|:..| ||..::    :.|:.....|...|:.  |..|..:.| .:.
Zfish   272 SKV-HLPDYDRFVIHAGECISDCPPGFTRDESHGVSVSMLCTACDGPCDKICDEKVIDSVDAAQS 335

  Fly   345 LQDCVTINGSLTIEL---TNIKEKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRG 406
            |:.|..|.|:|.|.:   |||..:    |||.|..:|.:|||:|:..|..|.||:||::|..|.|
Zfish   336 LKGCTVIKGNLHINIRRGTNIASE----LENFLGLIKTVTGYIKIRSSHTLTSLSFLKSLRYIHG 396

  Fly   407 DKLVENKYALYVVNNYHLEHIWP-PNHLVIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVA 470
            ::|.:|.||...::|.||:.:|. ..|.:.|..|.|:|.|||:||..:|.::..  |:|...:..
Zfish   397 EELWDNTYAFAALDNQHLQLLWDWSQHNLTISEGKLYFRLNPKLCMSEIRKMWA--KTGIKDNFV 459

  Fly   471 DVSPNSNGERVICGDAVRSLNPKVEDLNSTAVRIILDYMDWEG-----METLIGYSYHYKEAPVQ 530
            :....:||:|..||..:  |.....:..|..::::     ||.     ...|:.:..:|||||.|
Zfish   460 ERDFRNNGDRASCGTKI--LKFTSNNTRSNQIKLM-----WESYRPSDSRDLVNFIVYYKEAPFQ 517

  Fly   531 NVTMYDGRHGCGHDNW-LMDV-VPNQSRRH---VISGLKPYTQYAYFVKTLT-------RTEYHI 583
            |:|.:||:..||.|:| :::| :|::...:   |:|.|||:||||.|||.:|       |.:..:
Zfish   518 NITEFDGQDSCGSDSWDMVNVDLPDEKILNPGVVLSTLKPWTQYAIFVKAVTLIVEDRDRDKDRL 582

  Fly   584 QIDAYSKIGYFQTLPDRPS-PV-LRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKE 646
            .:...|::.|.:|.|..|| || :|.|.:|  ||::::.|.||..|||....|.:..::....:|
Zfish   583 HLGPQSEVVYIRTKPSAPSMPVDIRAYANS--SSKLVVRWAPPLAPNGNNTYYVLRWKQQGEDRE 645

  Fly   647 AKDKNYVNVEL--------------ENAKDIDCECAGVLPYYSGPQP---------DDEDYYNKE 688
            ....||.:.||              |:.|....|..|.......|.|         :|:.||.| 
Zfish   646 LYQHNYCSKELKIPVRVSATGLTDTEDTKPTYHETGGRDKTPCCPCPKTEEDLKRIEDDIYYRK- 709

  Fly   689 QITYEDALPNLIYVSRNHDYRRKEFEKVINYEHLLSIK-----------KDEEPTRPPTTTPAPT 742
              .:|:.|.|.|:..|..|.||::...|.|...:.::.           .|:||.|         
Zfish   710 --AFENFLHNAIFTPRPPDRRRRDLFGVANVTSIHTLLAGHWNLTEGNFSDDEPPR--------- 763

  Fly   743 NATLAKERLAAINYENYRLNSEKKQRDLQDLDQHKYTIRHALPKCQNSHASVVQQVEEKCVAEEP 807
                                     |:...|:                     ::|:|:.:    
Zfish   764 -------------------------REFSFLE---------------------RKVKERHI---- 778

  Fly   808 LSGYELPGTQHFYCLSQLEPETHYRITIRACVEGVVNGCSTPAEAVIKTASIQLERFIKG 867
                |:.|         |:|.|.|||.:.||.| .|..||..|....:|.:.:....|.|
Zfish   779 ----EITG---------LQPFTVYRIDLHACNE-EVRHCSAAAFVFSRTKAAEKADDIPG 824

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 41/116 (35%)
Furin-like 209..332 CDD:279142 36/138 (26%)
Recep_L_domain 347..461 CDD:279382 45/118 (38%)
FN3 491..578 CDD:214495 33/104 (32%)
igf1rbNP_694501.1 Recep_L_domain 47..162 CDD:279382 41/116 (35%)
Furin-like 176..320 CDD:279142 39/159 (25%)
FU 219..265 CDD:238021 13/46 (28%)
Recep_L_domain 338..449 CDD:279382 45/115 (39%)
FN3 483..595 CDD:238020 36/117 (31%)
FN3 600..>644 CDD:238020 16/46 (35%)
FN3 823..910 CDD:238020 1/3 (33%)
PTKc_InsR_like 980..1255 CDD:173625
Pkinase_Tyr 987..1253 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120934at33208
OrthoFinder 1 1.000 FOG0000777
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.