DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and igf1ra

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_694500.1 Gene:igf1ra ZFINID:ZDB-GENE-020503-1 Length:1405 Species:Danio rerio

Alignment Length:939 Identity:267/940 (28%)
Similarity:421/940 (45%) Gaps:205/940 (22%)


  Fly    24 LFLGASSPVLASSDDQTACGSLEI--------NKIADLRKLQNCTHVVGHVRLAYVDLTDVSGNY 80
            ||.|   |.|..|.....|...|:        |.|.:.:||:|||.|.|::::..:.  |.:.|.
Zfish    12 LFWG---PALFLSTICLRCARGEVCGPHIDIRNDITEFKKLENCTVVEGYLQILLIG--DKNNNL 71

  Fly    81 SLDSLAS----NVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRNLRELG 141
            :.:...:    .:|.::||::::|.:||.||..:||.|.:|||:.|.:: |:||::|..:|:::|
Zfish    72 NQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSVLFPNLNVIRGRNLFYN-YALVIFEMTSLKDIG 135

  Fly   142 LVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFSLKHNRPQSQC-PLCGSLSAD---- 201
            |..|..|..|.||:|.||.||::::|||..||......:  :..|:...:| .:|..::.|    
Zfish   136 LYNLRNITRGAIRIEKNPELCYLDSVDWSLLMDAEFNNY--IAGNKQTKECGDVCPGINKDRPHC 198

  Fly   202 --FEFIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCDSAGKCCDHNCVTGCYSQN----CS 260
              ..|..|.|.|||..|..|        |.||..|....|..||:||...|:..|...:    |:
Zfish   199 IRTSFNDNYSYRCWTSNHCQ--------KVCPKECEKRACTDAGQCCHPQCLGSCTEADNDKACA 255

  Fly   261 LCANYQGRMGCVNQCVA-SYELNKRRCIGHRECRELGRIP-----LIRGYQCVKKCPG--NQKEI 317
            .|.:|.....||..|.. :|:....|||....|..: .:|     :|...:|:..||.  .:.|.
Zfish   256 ACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARV-HLPSEVDFVIHNGECMPDCPPGFTRNET 319

  Fly   318 L-----VAKGIIHCQVECNGDFHVKSAADLEVLQDCVTINGSLTIELTNIK--EKIVDALENALA 375
            |     ...|:  |...|... .:.|....:.||.|..|.|:|.|   ||:  ..|...||:.:.
Zfish   320 LSMFCSACDGL--CDKVCESK-TIDSVDAAQSLQGCTVIKGNLQI---NIRRGNNIASELESFMG 378

  Fly   376 SVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENKYALYVVNNYHLEHIWP-PNHLVIIQRG 439
            .::.:|||:::.|:..|.||:||::|..|.|::||:|.||.:.|:|::|:::|. ..|.:.|:.|
Zfish   379 LIQTVTGYVRIKHTHTLGSLSFLKSLRYIVGEELVDNTYAFHAVDNHNLQYLWDWTQHNLTIRTG 443

  Fly   440 TLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGERVICGDAVRSLNPKVEDLNSTAVRI 504
            .|:|..||:||..:|.::.......|.::..||  .|||||..|...:  |..:.....||.:::
Zfish   444 KLYFRFNPKLCMSEIRKMWEKTSVREKMAEDDV--RSNGERASCESYI--LKFRSNHTQSTRIKL 504

  Fly   505 IL------DYMDWEGMETLIGYSYHYKEAPVQNVTMYDGRHGCGHDNW-LMDV-VPNQSRRH--- 558
            ..      ||.|      ||.:..:|||||.||:|.:||:.|||.::| ::|| :|.:....   
Zfish   505 TWERYRPPDYRD------LISFIVYYKEAPFQNITEFDGQDGCGSNSWNMVDVDLPQEKSIDPGV 563

  Fly   559 VISGLKPYTQYAYFVK--TLTRTEYHIQIDAYSKIGYFQTLPDRPSPVL--RIYGSSEISSQILL 619
            ::|.|||:||||.|||  ||...:.|:. .|.|::.|.:|....||..|  |.|.:|  ||.:::
Zfish   564 LLSPLKPWTQYAIFVKAVTLVVEDKHVG-GAKSEVVYIRTNASAPSMPLDARAYANS--SSSLMV 625

  Fly   620 HWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELENAKDIDCECAGVLPYYSGPQPDDEDY 684
            .|.||..||| .|.::|...:                                    .|.:|.:.
Zfish   626 KWSPPIAPNG-NKTFYVLRWQ------------------------------------QQAEDGEL 653

  Fly   685 YNKEQITYEDALPNLIYVSRNHDYRRKEFEKV---INYEHLLSIKKDEEPTRPPTT------TPA 740
            |                   .|:|..||. |:   |:...|..::.:.:||:....      .|.
Zfish   654 Y-------------------QHNYCSKEL-KIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPC 698

  Fly   741 P-TNATL---AKERLAAINYENYRLNS-------EKKQRDLQDLDQHKYTIRHALPKCQNSHASV 794
            | |...|   |::|.....:||:..||       ::|:|||..:                :::::
Zfish   699 PKTKEDLKAEAEDRSYRKVFENFLHNSIFTPRPPDRKRRDLMGV----------------ANSTL 747

  Fly   795 VQQVEEK-CVAEEPLSGYELP--------GTQH--FYCLSQLEPETHYRITIRACVEGVVNGCST 848
            |..|... .|.|..::..|||        |..|  |..:..|.|.|.|||.|.|| ...|:.||.
Zfish   748 VSGVSRNISVLESNITQPELPEKEYPFSEGKVHTEFMEIHNLRPFTVYRIDIHAC-NYEVHRCSA 811

  Fly   849 PAEAVIKT----------ASIQLERFIKG 867
            .|....:|          .|:..||..||
Zfish   812 AAFVFSRTKPADKADDIPGSVTQERDEKG 840

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 43/119 (36%)
Furin-like 209..332 CDD:279142 38/140 (27%)
Recep_L_domain 347..461 CDD:279382 41/117 (35%)
FN3 491..578 CDD:214495 37/100 (37%)
igf1raNP_694500.1 Recep_L_domain 51..167 CDD:279382 43/119 (36%)
Furin-like 182..333 CDD:279142 42/162 (26%)
FU 235..275 CDD:214589 10/40 (25%)
Recep_L_domain 351..465 CDD:279382 41/117 (35%)
FN3 497..602 CDD:238020 41/112 (37%)
FN3 607..>651 CDD:238020 18/83 (22%)
FN3 844..921 CDD:238020
PTKc_IGF-1R 990..1266 CDD:133193
Pkinase_Tyr 997..1264 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120934at33208
OrthoFinder 1 1.000 FOG0000777
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.