DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and insra

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_005171317.1 Gene:insra ZFINID:ZDB-GENE-020503-3 Length:1362 Species:Danio rerio

Alignment Length:893 Identity:258/894 (29%)
Similarity:399/894 (45%) Gaps:176/894 (20%)


  Fly    42 CGSLEI-NKIADLRKLQNCTHVVGHVRLAYVDLT---DVSG-NYSLDSLASNVTEISDYLMVYRC 101
            |.|.:| |.:.:||.|:|||.:.||:::..:..|   |..| :|      ..:|.::|||:::|.
Zfish    36 CSSKDIRNNVTNLRVLENCTVIEGHLKILLMFTTKPEDFRGLSY------PKLTVVTDYLLLFRV 94

  Fly   102 TGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRNLRELGLVELLRIQSGFIRVESNPLLCFVET 166
            .||.||..:||.|.::||..|.|: |:||::|...|:|:||..|:.|..|.:|||.||.||::.|
Zfish    95 YGLESLSDLFPNLTVVRGNNLFFN-YALVLFEMLQLKEIGLHSLMNITRGAVRVEKNPDLCYLST 158

  Fly   167 VDWIYLMGNATRQHF-SLKHNRP-----------QSQCPLCGSLSADFEFIRNSSERCWNVNTTQ 219
            :||..::.:....:. :.|::|.           ::.|||. :::.||      ||||||....|
Zfish   159 LDWSMILDSVEDNYIVANKNDRECGDICPGTVLGKTTCPLT-TINGDF------SERCWNQKYCQ 216

  Fly   220 LRPQPPRLKDCPIACGLNGCDSAGKCCDHNCVTGCY----SQNCSLCANYQGRMGCVNQCV-ASY 279
                    :.||.:|....|....:||...|:.||.    |..|..|.|:.....||.:|. ..|
Zfish   217 --------RMCPSSCKHRACTKDSQCCHDQCLGGCLEPHSSNKCVACRNFMHNNMCVEKCPHGFY 273

  Fly   280 ELNKRRCIGHRECREL------GRIP----LIRGYQCVKKCPGNQKEI-------LVAKGIIHCQ 327
            .....||:....|:||      |:..    :|....|:.:||.....:       ....|:  |.
Zfish   274 TFKGWRCVSFSFCQELHNKCKQGKGDCHEYVIHNGACIPECPSGYTTVNSTTLNCTPCAGL--CP 336

  Fly   328 VECNGDFHVKSAADLEVLQDCVTINGSLTIELTNIK--EKIVDALENALASVKEITGYLKVIHSA 390
            ..|.|...|.|....:.|:.|..|||||.|   ||:  ..|...||..|..::||||||.|.||.
Zfish   337 KVCMGLKTVDSVTAAQALRGCTVINGSLVI---NIRGGNNIAAELEANLGQLEEITGYLTVRHSY 398

  Fly   391 QLMSLTFLQNLDAIRGDKLVENKYALYVVNNYHLEHIWP-PNHLVIIQRGTLFFHLNPRLCYEKI 454
            .|:||:||:.|..|.|:......|:.|.::|.:|..:|. ..|.:.||:|.:|||.|.:||..:|
Zfish   399 ALVSLSFLRKLRIIHGETQEVGNYSFYALDNQNLRQLWDWSKHNLTIQQGRMFFHHNSKLCMSEI 463

  Fly   455 HQLQGSLKSGENISVADVSPNSNGERVICGDAVRSLNPKVEDLNSTAVRIILDYMDWEG-----M 514
            .:::....:....:..|:...:||::..|...|.    |...:::.:.:||:   .||.     .
Zfish   464 RRMEEVTGTKNRQTKNDIVSKTNGDQASCESKVL----KFTRISTLSDKIII---KWEAFWPPDF 521

  Fly   515 ETLIGYSYHYKEAPVQNVTMYDGRHGCGHDNWLM-DVVP----NQSRRH----VISGLKPYTQYA 570
            ..|:|:...|||||.:|||.:||:..||.::|:: ||.|    .:.:.|    :|..|||:||||
Zfish   522 RDLLGFMVLYKEAPYKNVTEFDGQDACGSNSWVIADVDPPPRATEGKEHEPGYLIFPLKPWTQYA 586

  Fly   571 YFVKT-LTRTEYHIQIDAYSKIGYFQTLPDRPSPVLRIYGSSEISSQILLHWWPPRRPNGVIKNY 634
            ..||| |:.::.|....|.|:|.|.:|...:||..|....||..||||:|.|.||..|||.|.:|
Zfish   587 IMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHY 651

  Fly   635 FVTAEKYNATKEAKDKNYVNVELENAKDIDCECAGVLPYYSGPQPDDEDYYNKEQITYEDALPNL 699
            .|..::.....|....:|            |:....||..:..|.|:|:.....|.  |:..|: 
Zfish   652 LVFCQQQPEASELYKFDY------------CQKGMKLPTRAPTQVDNEEEQKWNQT--EEQGPD- 701

  Fly   700 IYVSRNHDYRRKEFEKVINYEHLLSIKKDEEPTRPPTTTPAPTNATLAKERLAAINYENY----- 759
               ||.....:.|.:          :||:.|.|....|                  :|||     
Zfish   702 ---SRCCACPKTEKQ----------LKKEAEETEYRKT------------------FENYLHNEV 735

  Fly   760 -RLNSEKKQRDLQDL----DQHKYTIRHALP----------KCQNSHASVVQQVEEKCVAEEPLS 809
             .|...:::|.|..:    ....:|...:||          :.:.:..|::.|.:|..|      
Zfish   736 FELRPSRQRRSLVGIANRTSSRLFTTPSSLPNGSATRSPEEEAEANKISLIVQAKESTV------ 794

  Fly   810 GYELPGTQHFYCLSQLEPETHYRITIRACVEGV-VNGCSTPAEAVIKT 856
               :...:||         |.|:|.|.||..|. ...||..|....:|
Zfish   795 ---ISNLRHF---------TSYQIEIHACNHGSDPTRCSMAAYVSART 830

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 46/119 (39%)
Furin-like 209..332 CDD:279142 37/145 (26%)
Recep_L_domain 347..461 CDD:279382 46/117 (39%)
FN3 491..578 CDD:214495 36/102 (35%)
insraXP_005171317.1 Recep_L_domain 53..165 CDD:279382 46/119 (39%)
Furin-like 179..337 CDD:279142 42/175 (24%)
FU 234..281 CDD:238021 15/47 (32%)
Recep_L_domain 356..470 CDD:279382 46/117 (39%)
FN3 618..>660 CDD:238020 19/42 (45%)
FN3 851..930 CDD:238020
PTKc_InsR 996..1283 CDD:133192
Pkinase_Tyr 1003..1270 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120934at33208
OrthoFinder 1 1.000 FOG0000777
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.