DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and rol-3

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001256097.1 Gene:rol-3 WormBaseID:WBGene00004395 Length:2481 Species:Caenorhabditis elegans

Alignment Length:970 Identity:174/971 (18%)
Similarity:323/971 (33%) Gaps:362/971 (37%)


  Fly    10 PLPIPISIAVPLI------LLFLGASSPVL--------ASSDDQ--------------TACGSLE 46
            |.|:|....:..|      .:.:|:|...|        .:.:||              |....:|
 Worm   354 PFPLPTDDTITAIAGISDTTIAIGSSKGSLWTYQMSANQTDEDQPSSVIQLKTVGEMDTKINQIE 418

  Fly    47 INKI---------------ADLRKLQ-----NCTHVVGHVRLAYVDLTDVSGNYSLDSLASNVTE 91
            |:.|               ..||.::     ||..:|.:      |..:.....:|||:..:|..
 Worm   419 IDHIQRTLYAVQHDKGIIRCKLRTMEAEESPNCVLIVNN------DALNAPKEITLDSVNGHVYT 477

  Fly    92 ISDYLMVYR-------CTGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRNLRELGLVELLRIQ 149
            ::....|||       .||:.::.|:.....:.....:.||....::|.             .:|
 Worm   478 LNADNKVYRTEMVAFNATGIETVASLQYLQDMSPSNGIFFDVSKFLLYS-------------ALQ 529

  Fly   150 SGFIRVESNPLLCFVETVDWIYL---MGNATRQHFSLKHNRPQSQCPLCGSLSAD-----FEFIR 206
            :|.: :..||:      .|.:::   :|.|..|||.:|::........||...||     .|.::
 Worm   530 NGSM-MTLNPV------TDHVHIFKDVGYADIQHFRIKNDLIYWMKKKCGETDADENCIFAENLQ 587

  Fly   207 NSSERCWNVNTTQ-------------LRPQPPRLKDCPIACGLNGCDSAGKCCDHNCVTGCYSQN 258
            .|.|...|..|..             |:   ||:........|....:|....|.:......:|.
 Worm   588 RSEEDIPNKFTYSSSLMSFGVLEEILLK---PRITAVSTIAMLTSDKTARVSWDESNTLPFQAQG 649

  Fly   259 CSLCANYQGRMGCVNQCVASYELNKRRCIGHRECRELGRIPLIRGYQCVKKCPGN-QKEILVAKG 322
            .| ..|:            :|.|..             ..|.|..:..::....| :.:|.|..|
 Worm   650 SS-WRNF------------TYFLKV-------------TAPDITDFSPIEIYTSNTEMKIDVTPG 688

  Fly   323 -IIHCQVE-CNGDF----------------------HVKSAAD----LEVLQDCVTINGSLTIEL 359
             |.:.||: |:.||                      ..|..||    :::|.:.:..:.|:    
 Worm   689 NIYNAQVQVCSDDFCSIPTSTSNTALPDLGDVVPFVFTKRQADDIISVDILGNIIPADDSV---- 749

  Fly   360 TNIKEKIVDALE--NALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRG------DKLVENKYAL 416
                 |||:.|:  :.|.:..: |.||...||..:    |.:.||...|      |.|.....::
 Worm   750 -----KIVEKLQYPHVLDNTTK-TVYLAGDHSMGI----FKKYLDDTAGLPKPFKDGLFVEMMSI 804

  Fly   417 ------------YVVNNYHLE--------------------------------H----------- 426
                        |.:.:|.|.                                |           
 Worm   805 MPARSIILIASSYKITSYRLPTTFDFEYFSCEEPLEACSEVMGISSDDTTGMVHFLTQARNGTIT 869

  Fly   427 IW---PPNHL---------VIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGE 479
            :|   |.|..         ::..|..|..|....|..:..|.:|    :.:.:.|.:|:  :..|
 Worm   870 LWESDPENRTPRDIASVPSIVPFRRFLILHDKMILVTKNNHIVQ----TDKKLKVVNVA--TELE 928

  Fly   480 RV--ICGDAVRSLNPKVEDLNSTAVRIILDYMDWEGMETLIGYSYHYKEAPVQ------NVTMYD 536
            ||  |......:::.|:|  .|..::.|      :|.:|.:.::.   ..|::      .|:::.
 Worm   929 RVDHILPLRYATISHKIE--FSDEIKFI------DGSKTNLQWTL---SPPLEAGTVLFKVSIFR 982

  Fly   537 GRHGCGHDNWLMDV-------VPNQ-------SRRHVISGLKPYTQYAYFVKTLTRTEYHIQIDA 587
            .:.| |.|..::.:       :|::       ::|..:| ::..|.:|..|  |.||..      
 Worm   983 EKMG-GQDPPIITIQSETNFTIPSEVLEAWSSAQRFDVS-VQAMTPWATAV--LNRTGL------ 1037

  Fly   588 YSKIGYFQTLPDRP--SPV-LRIYGSSEIS-----SQILLHWWPPRRPNGVIKNYFVTAEKYNAT 644
                    |.|.:|  ||. |||:.:.:.:     :.|...|.||...||....|.|     |.|
 Worm  1038 --------TAPVKPPTSPTQLRIFATQQKTVDGPRALISFFWGPPSEWNGTPYQYIV-----NCT 1089

  Fly   645 KE---------AKDKNYVNVELENAKDIDCECAGVLPYYSGPQPDDEDYYNKEQITYE------- 693
            |:         ...:::.:..:::.| :.|:.|      :..:|.:...:: |.||.:       
 Worm  1090 KDDGSWIGGPVTTSQSHYSFAVKSGK-VSCQAA------AANEPTNIGSFS-ELITIDSSELKPL 1146

  Fly   694 ------DALPNLIYVS-RNHDYRRKEFEKV-----INY-------EHLLSIKKDEEPTRP 734
                  |:..:||.:: ..|:..|:|..:|     :.|       |.|.:::|:.|..:|
 Worm  1147 VKLFAIDSTNSLISINDLAHEEPRRETRQVAQPVKLEYQAMAFIGEDLYAVRKEGESAQP 1206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 22/125 (18%)
Furin-like 209..332 CDD:279142 24/139 (17%)
Recep_L_domain 347..461 CDD:279382 30/189 (16%)
FN3 491..578 CDD:214495 18/107 (17%)
rol-3NP_001256097.1 FN3 1542..1636 CDD:238020
fn3 1664..1749 CDD:278470
STYKc 1966..2232 CDD:214568
PTKc 1970..2233 CDD:270623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.