DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and insr

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_002934425.2 Gene:insr XenbaseID:XB-GENE-920733 Length:1360 Species:Xenopus tropicalis

Alignment Length:952 Identity:276/953 (29%)
Similarity:405/953 (42%) Gaps:218/953 (23%)


  Fly     2 GHLHPVPNPLPIP--ISIAVPLILLFLGASSPVLASSDDQTACGSLEI-NKIADLRKLQNCTHVV 63
            |..||..||....  .|||...|:..|     :|...:|...|.|::| |.|:....|::||.:.
 Frog     8 GEGHPNNNPKSKVGWKSIAGIFIIFML-----ILCDQNDGKICPSMDIRNNISQFSMLEDCTVIE 67

  Fly    64 GHVRLAYVDLTDVSGNYSLDSLASNVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELLFDQYS 128
            ||:::..: .|....|:. ......:|.|:|||:::|..||.||:.:||.|.:|||..|.|: |:
 Frog    68 GHLQILLM-FTSKPENFR-GLRFPKLTMITDYLLLFRVYGLESLKDLFPNLTVIRGTHLFFN-YA 129

  Fly   129 LVVYENRNLRELGLVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFSLKHNRPQSQ-- 191
            ||::|..:|:|:||..|:.|..|.:|:|.|..||::.|:||..::.:....:..|  ||...:  
 Frog   130 LVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILDSVEDNYIEL--NRDNKEEC 192

  Fly   192 ---CP-------LCGSLSADFEFIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCDSAGKCC 246
               ||       .|..:..:..||    ||||..:..|        ..||..|..:||...|:||
 Frog   193 GDVCPGAGKGKSKCKQIVVNGAFI----ERCWTQDHCQ--------TVCPSECKGSGCLPDGQCC 245

  Fly   247 DHNCVTGCYSQN----CSLCANYQGRMGCVNQC-VASYELNKRRCIGHRECREL-GRIP------ 299
            ...|:..|...|    |:.|.:||.:..|::.| ..||.....|||....|:|: .|.|      
 Frog   246 HSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSC 310

  Fly   300 ---LIRGYQCVKKCPGNQKEILVAKGIIHCQVECNGDF-----------HVKSAADLEVLQDCVT 350
               :|...:|:..||..    .:|.........|.|..           .:.|....:.|:.|..
 Frog   311 PPYVIHKGECMPDCPSG----YIANSTTRTCTPCAGPCPKVCTIYQSVKTIDSVTSAQELRGCTV 371

  Fly   351 INGSLTIELTNIK--EKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENK 413
            :||||.|   ||:  ..|...||..|..::||:||||:..|..|:||:|.:.|..|||:.|....
 Frog   372 VNGSLII---NIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEVLEAGN 433

  Fly   414 YALYVVNNYHLEHIWP-PNHLVIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSN 477
            |:.|.::|..|..:|. ..|.:.|..|.||||.|||||..:|||::....:.......|:|..:|
 Frog   434 YSFYALDNPSLRQLWDWHKHNLTIIHGKLFFHHNPRLCLAEIHQMEEVTGTKGRQDKNDISTKTN 498

  Fly   478 GERVICGDAVRSLNPKVEDLNSTAVRIIL--------DYMDWEGMETLIGYSYHYKEAPVQNVTM 534
            |::..|.|.:.:.|    .:.::...::|        ||.|      |:|:..||||||.||||.
 Frog   499 GDQASCEDNLLNFN----FIRTSHDMVLLKWDPYWPPDYRD------LLGFMVHYKEAPYQNVTE 553

  Fly   535 YDGRHGCGHDNWL---MDVVPNQSRRHVIS------GLKPYTQYAYFVKTLT------RTEYHIQ 584
            :||:..||.::|.   ||.....:....:|      .|||:||||.|||||.      ||     
 Frog   554 FDGQDACGSNSWTVVDMDAPERSADGKTLSPGCLLRNLKPWTQYAVFVKTLVSGSDEGRT----- 613

  Fly   585 IDAYSKIGYFQTLPDRPSPVLRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKD 649
            ..|.|||.|.:|....||..|..:..|..:|||:|.|.||..|||.:.:|.|..::.....|..:
 Frog   614 YGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLVYWQEQPEDSELYE 678

  Fly   650 KNYVNVELE----------------NAKDID------CECAGVLPYYSGPQPD-------DEDYY 685
            .:|.|..|:                |....|      |.|         |:.|       ||..:
 Frog   679 LDYCNKGLKLPSRTWTPPSDIEENGNINQTDQPSSKCCPC---------PKTDFQIQKEQDESAF 734

  Fly   686 NKEQITYEDALPNLIYVSRNHDYRRKEFEKVINYEHLLSIKKDEEPTRP-PTTTPAPTNATLAKE 749
            .|   |:|:.|.|.:::.|....||:.| .|.|            .|.| |.|.|:..||:    
 Frog   735 RK---TFENYLHNEVFIPRPVRKRRELF-GVAN------------GTLPDPVTAPSLFNAS---- 779

  Fly   750 RLAAINYENYRLNSEKKQRDLQDLDQHKYTIRHALPKCQNSHASVVQQVEEKCVAEEPLSGYELP 814
                    :.|...|.:                  ||..:          :|...:|.|.   :.
 Frog   780 --------STRAPDETE------------------PKIYS----------QKVWFKESLM---VT 805

  Fly   815 GTQHFYCLSQLEPETHYRITIRACVEGVVNGCSTPAEAVIKT 856
            |.:||         |.|||.|.||...:..|||..|....:|
 Frog   806 GLKHF---------TGYRIEIHACNHELSMGCSVAAYVSART 838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 43/115 (37%)
Furin-like 209..332 CDD:279142 37/138 (27%)
Recep_L_domain 347..461 CDD:279382 48/117 (41%)
FN3 491..578 CDD:214495 37/110 (34%)
insrXP_002934425.2 Recep_L_domain 62..174 CDD:279382 43/115 (37%)
Furin-like 189..346 CDD:279142 43/173 (25%)
FU 244..290 CDD:238021 14/46 (30%)
Recep_L_domain 368..482 CDD:279382 48/117 (41%)
FN3 510..625 CDD:238020 44/130 (34%)
FN3 630..>673 CDD:238020 16/43 (37%)
FN3 851..939 CDD:238020
PTKc_InsR 1003..1290 CDD:133192
Pkinase_Tyr 1010..1277 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120934at33208
OrthoFinder 1 1.000 FOG0000777
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.