DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sdr and igf1r

Sequence 1:NP_001287331.1 Gene:Sdr FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_002933351.1 Gene:igf1r XenbaseID:XB-GENE-484032 Length:1362 Species:Xenopus tropicalis

Alignment Length:914 Identity:250/915 (27%)
Similarity:414/915 (45%) Gaps:204/915 (22%)


  Fly    21 LILLFLGASSPVLASSDDQTACG-SLEI-NKIADLRKLQNCTHVVGHVRLAYVDLTDVSGNYSLD 83
            |:||.||.|:        ...|| :::| |.:.:|::|::|..:.|::::..:      .|...:
 Frog    19 LLLLCLGPSA--------GRVCGPNMDIRNDVRELKQLEDCVVIEGYLQILLI------SNAKAE 69

  Fly    84 SLAS----NVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRNLRELGLVE 144
            ...:    .:|.|:|||:::|.:||:||.::||.|.:|||: :||..|:||::|..:|:|:||..
 Frog    70 DFRNLRFPKLTVITDYLLLFRVSGLVSLSNLFPNLTVIRGR-VLFYNYALVIFEMTDLKEIGLYN 133

  Fly   145 LLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFSLKHNRPQSQC-----------PLCGSL 198
            |..|..|.:|:|.|..||:|.||||..:: :|...:: :..|:|..:|           .:|...
 Frog   134 LRNITRGAVRIEKNSELCYVSTVDWSLIL-DAVYNNY-IVGNKPPKECVDLCPGAREKMQICEKS 196

  Fly   199 SADFEFIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCDSAGKCCDHNCVTGCYSQN----C 259
            |.:.||    ::|||:....|        |.||..||...|....:||...|:..|.:.:    |
 Frog   197 SINNEF----ADRCWSDEHCQ--------KACPGVCGKRACTDNKECCHPECLGSCMAPDNDTAC 249

  Fly   260 SLCAN--YQGRMGCVNQCVA-SYELNKRRCIGHRECRELGRIP------LIRGYQCVKKCPG--- 312
            ..|.:  |:||  ||..|.. :|:....|||...||.::..:.      :|...:||.:||.   
 Frog   250 VACHHYFYEGR--CVPTCPPNTYKFEGWRCITREECAKMHIVVNSLTPFIIHKGECVYECPSGFM 312

  Fly   313 -NQKEILV---AKGIIHCQVECNGDFH-VKSAADLEVLQDCVTINGSLTIELTNIK--EKIVDAL 370
             |:.:.:.   .:|  .|...|:.... :.|....::|:.|..:.|:|.:   ||:  :.|...|
 Frog   313 LNESQSMTCSPCEG--PCPKVCDEKMKTIDSVTSAQMLEGCTVLKGNLQL---NIRKGQNIASEL 372

  Fly   371 ENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENKYALYVVNNYHLEHIWP-PNHLV 434
            ||.|..::.:|||:|:.||..|:||:||::|..|.|::.:...|:.||.:|.:|:.:|. ..|.:
 Frog   373 ENFLGLIETVTGYVKIRHSHALVSLSFLKSLRYILGEEQMPGNYSFYVFDNNNLQQLWDWSKHNL 437

  Fly   435 IIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGERVICGDAVRSLNPKVEDLNS 499
            .|:.|.:.|..|.:||..:|::::....:....:..|:|.::||....|...|         ||.
 Frog   438 TIKEGKIRFAFNSKLCASEIYRMEEVTGTKGRQTAEDISLSTNGNMASCESHV---------LNF 493

  Fly   500 TAV-----RIIL--------DYMDWEGMETLIGYSYHYKEAPVQNVTMYDGRHGCGHDNW-LMDV 550
            |::     ||..        ||.|      ||.::.:||||...|||.|||:..||.::| ::||
 Frog   494 TSIITSKNRIKFTWERYRPPDYRD------LISFTVYYKEALFHNVTEYDGQDACGSNSWNMVDV 552

  Fly   551 VPNQSRRH----VISGLKPYTQYAYFVKTLTRT---EYHIQIDAYSKIGYFQT---LPDRPSPVL 605
            ....|:..    ::.||||:||||.:||.:|.|   ..||. .|.|||.|.:|   :|..|..|:
 Frog   553 DLPASKESDPGILLQGLKPWTQYAIYVKAITLTMLESRHIH-GAKSKIIYIRTDAAVPSIPQDVI 616

  Fly   606 RIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELENAKDIDCECAGV 670
               .:|..|||:::.|..|.:|||.:..|.|..::                              
 Frog   617 ---SASNSSSQLVVKWNSPSQPNGNLSYYIVRWQQ------------------------------ 648

  Fly   671 LPYYSGPQPDDEDYYNKEQITYEDALPNLIYVSRNHDYRRKEFEKVINYEHLLSIKKDEEPTR-- 733
                   ||.|...| :....:.|.:||           ||.....|:.|.:..:.|.|..|.  
 Frog   649 -------QPQDRHLY-QYNYCFRDKVPN-----------RKYANGTIDTEGVTELTKPEGNTGEK 694

  Fly   734 ------PPTTTPAPTNATLAKERLAAINYENYRLNS------EKKQRDLQDLDQHKYTIRHALPK 786
                  |.|..........|:.|..   :||:..||      .:::||:       :.:.::   
 Frog   695 GHCCACPKTEAEKKAEKDEAEYRKV---FENFLHNSIFVPRPNRRRRDV-------FAVGNS--- 746

  Fly   787 CQNSHA--SVVQQVE-----EKCVAEEPLSGYELPGTQHFYCLSQLEPETHYRITIRAC-VEGVV 843
            .|.||.  :.|:...     ||...|.|....::...:....:|.|:|.|.|||.|.:| .|...
 Frog   747 TQTSHGKNTTVEDFSNFSDFEKEDVEYPFYETKIDYKRERTVISNLQPFTLYRIDIHSCNHEAEK 811

  Fly   844 NGCS 847
            .|||
 Frog   812 LGCS 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 42/119 (35%)
Furin-like 209..332 CDD:279142 37/143 (26%)
Recep_L_domain 347..461 CDD:279382 38/117 (32%)
FN3 491..578 CDD:214495 37/105 (35%)
igf1rXP_002933351.1 Recep_L_domain 50..162 CDD:279382 42/119 (35%)
Furin-like 176..330 CDD:279142 41/170 (24%)
FU 231..277 CDD:238021 14/48 (29%)
Recep_L_domain 350..464 CDD:279382 38/117 (32%)
FN3 492..604 CDD:238020 44/119 (37%)
FN3 609..>653 CDD:238020 17/84 (20%)
FN3 834..921 CDD:238020
PTKc_InsR_like 992..1268 CDD:173625
Pkinase_Tyr 999..1266 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D120934at33208
OrthoFinder 1 1.000 FOG0000777
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.