DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and NUP93

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_055484.3 Gene:NUP93 HGNCID:28958 Length:819 Species:Homo sapiens

Alignment Length:829 Identity:302/830 (36%)
Similarity:463/830 (56%) Gaps:56/830 (7%)


  Fly     6 LLQRAQNLNNDAKAECELPAVERTLQQVLRATTELHSR-VTQTG--CKEIQAHILLGSKGVDLPK 67
            |||:|:.|..:.:...|||.|||.||::.:|...|.|| :|:|.  ..:::|.:||||:|:|:..
Human     9 LLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLDISH 73

  Fly    68 LNQKLEALSARKTFEPLDVKADTDVRTFLKNERENAILSVIEDTKKNISDSANKQRWASMNKVWN 132
            ::|:||:|||..|||||:...|||::.|||||::||:||.||:::|.....|.:....||...|.
Human    74 ISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWE 138

  Fly   133 EEKTRLLDALIAPSQNFIDLQRLPEPTIVNPLCQP-RSCLDPLELVYAQELRHYNELLLKSSHRP 196
            :.|.|:|..|:|..::.:|..:..||:.::.:..| ||.||.:|:.||:::..|||.::....:|
Human   139 QVKQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQP 203

  Fly   197 NLVQKFAHLSQSFGDCRLTDMWTLLACVTQISEPLRSDPIKSR---QQRPEFVTYAKSYLERRYR 258
            |||...|.::: ..|..::||||::..:|.:.....:|.:|:|   :.|.|||..|.:|||:.|:
Human   204 NLVDLCASVAE-LDDKSISDMWTMVKQMTDVLLTPATDALKNRSSVEVRMEFVRQALAYLEQSYK 267

  Fly   259 VFMC---------SQVGGSYANNSYQLVVAYVNHRFRAQQTIGLVD-TVREIPLWPLVYYGLRCG 313
            .:..         :|:||  ...:||||.:::|.:..|... ||.| .|...|:|.|:||.:|||
Human   268 NYTLVTVFGNLHQAQLGG--VPGTYQLVRSFLNIKLPAPLP-GLQDGEVEGHPVWALIYYCMRCG 329

  Fly   314 AVKVAVEFLREAGSSHDEFAQLVADRNAGETNSK-------IENQLRLQYANKIRNSTDAYKKAV 371
            .:..|.:.:..|.....||.....:    ..|||       .||:|||.|...:||:||.||:||
Human   330 DLLAASQVVNRAQHQLGEFKTWFQE----YMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAV 390

  Fly   372 YCILLGCDVNEVHGEVAKTIDDFLWMRLAMI--------QPGDADNYGKLQSMILEQYGEKYFNA 428
            |||:..|||.:...|||...:|:||::|..:        .|.|.....:.|..:||.|||.:|..
Human   391 YCIIGRCDVTDNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTV 455

  Fly   429 RQQPYLYFETLALTGQFEAAIEFLARQDENRAHAVHMAIALFELGLLGSARSVSQPLLSIDIKDP 493
            .|||:|||:.|.||.|||||:.||.|.:..|.||||:|:.||||.||..:...|..|||.:..||
Human   456 NQQPFLYFQVLFLTAQFEAAVAFLFRMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDP 520

  Fly   494 QPLRRLNLTRLIRQYVQRFERTDTSEALHYYYTLRCLKDSKGRNMFMACVCDLVVDSGVFDTTIF 558
            ..|||||..||:..|.::||.||..|||.|:|.||..|||:|.|||:.||.:||::|     ..|
Human   521 PCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDSQGENMFLRCVSELVIES-----REF 580

  Fly   559 DLIFGKRQSSDQNDVNSGLFRQFECPEFDTRTMAAQVGDELAALGNFEMSARLYEMAGKYNLAVK 623
            |:|.||.::....  ..|:..:|..   ||:.:..:|.......|.||.:|:||::|...:..::
Human   581 DMILGKLENDGSR--KPGVIDKFTS---DTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLE 640

  Fly   624 HICILMAQVVHLPTLGGSLRERLGQDAQRFNQLLASDSIDVEPKMKSSFVLLQDLLIFFNFYHDG 688
            .:..|::.||...:...|.:|||...|....:...:..|.....:.|:|.||.||:.||:.||.|
Human   641 LMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSG 705

  Fly   689 KFNAALDLLRQTQLVPNTLDDVDVVLGNVKQLSGEVIKVLPDVIVAAMEIAQKQYKQLKAGSGSS 753
            ..:.|.|::.:.:|||...:.|:..:...:..|.|:...|.:|::|.|.|...|:|:||..|.||
Human   706 HIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSS 770

  Fly   754 LEQTQM------QQLRQRAKALSNMAATMPYRLPNDTNKRLIELELDMH 796
            ..:.|.      .|||.:|:.|...|..:|||...|||.||:::|:.|:
Human   771 SSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 18/60 (30%)
Nic96 213..781 CDD:282017 214/602 (36%)
NUP93NP_055484.3 Nic96 220..802 CDD:282017 213/599 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C308323216
eggNOG 1 0.900 E1_KOG2168
Hieranoid 1 1.000
Homologene 1 1.000 H40971
Inparanoid 1 1.050 477 1.000 Inparanoid score I1470
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D187731at2759
OrthoFinder 1 1.000 FOG0002843
OrthoInspector 1 1.000 T609733
orthoMCL 1 0.900 OOG5_129616
Panther 1 1.100 LDO PTHR11225
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R780
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.