DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and AT3G57350

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_191294.5 Gene:AT3G57350 AraportID:AT3G57350 Length:860 Species:Arabidopsis thaliana

Alignment Length:853 Identity:181/854 (21%)
Similarity:331/854 (39%) Gaps:171/854 (20%)


  Fly     6 LLQRAQNLNNDAKAECELPAVERTLQQVLRATTELHSRV--TQTGCKEIQAHILLGSKGVDLPKL 68
            ||..:..|...|....:.|.::|.|.|:...:.:|.::.  .:...:.|.|..||..:|::..:|
plant    13 LLHSSTKLLEQAAPSSQFPPLQRNLDQLEALSRKLKAKTLRNEAPSQSIAATRLLAREGINADQL 77

  Fly    69 NQKLEALSARKTFEPLDVKADTDVRTFLKNERENAILSVIEDTKKNISDSANKQRWASMNKVWNE 133
            ::.|::...:.|||.:.....|.|..:|:...|.|::|.|::.:|:...|.|..    |.||..|
plant    78 SRDLKSFELKTTFEDVFPAETTSVEEYLQQVHEMAMVSAIQEAQKDNVRSFNNY----MLKVLEE 138

  Fly   134 ----EKTRLLDALIAPSQNFIDLQRLPEPTIVN-----------PLCQPRSCLDPLELV------ 177
                ||...|.:|...|.       ||:..::|           ||....|.....|||      
plant   139 DCIKEKRDFLHSLSKTSM-------LPKTKMINSSRGSHAGSLVPLSPQVSSKPGTELVSMTNKP 196

  Fly   178 -YAQELRHYNELL--LKSSHRPNLVQKFAHLSQSFGD-----------CRLTDMWTLLACVTQIS 228
             :.::...|.|::  |.|:....|..|.|.|.....:           ..:..:|.|:..:|...
plant   197 IHEKKAYVYAEVVKKLNSARERGLPFKLATLFNGAYESLEIDLTRGKSVNMQKLWQLIQGMTGEE 261

  Fly   229 EPLRSDPIKSRQQRPEFVTYAKSYLERRYRVFMCSQV---------GGSYANNSYQLVVAYVNHR 284
            ..::....|    |...|..|:.:||..:...:...:         |||..|  .|.:.|::..|
plant   262 SAVQHGVSK----RMALVIGARRHLECGHGKHIMDTIQSHPTQAALGGSVGN--LQRIRAFLRIR 320

  Fly   285 FRAQQTIGL--VDTVREIPL---WPLVYYGLRCGAVKVAVEFLREAGSSHDEFAQL--------- 335
            .|...::..  ||..|:.|:   |..:|:.||.|..:.|.|..:.:.||..:||.|         
plant   321 LRDYGSLDFDSVDARRQPPVDTTWQQIYFCLRTGYYEEAREIAQSSRSSQQQFAPLLTEWITTGG 385

  Fly   336 -VADRNAGETNSKIENQLRLQYANKIRNST-DAYKKAVYCILLGC--DVNEVHGEVA---KTIDD 393
             ||.:.|...:.:.|..||:  .::...:| |..|..:|.|:.|.  .::.:..:.:   .||:|
plant   386 TVAAQTAATASEECEKLLRM--GDRFGQTTYDKKKLLLYTIISGSRRQIDRIMRDFSTLFNTIED 448

  Fly   394 FLWMRLAMIQPGDADNYGKLQSMI------------LEQYGEK-----YFNARQQPYLYFETLAL 441
            |||.:|:.::    |..|...|||            |:.|..|     |....:.|.:|...|.|
plant   449 FLWFKLSCVR----DVAGGSSSMIVNDGLVPYSLDDLQAYLNKFEPSYYTKNGKDPLVYPYVLLL 509

  Fly   442 TGQFEAAIEFLARQ--DEN-RAHAVHMAIALFELGLLGSARSVSQPLLSIDIKDPQPLRRLNLTR 503
            :.|...||..::.:  ||. ...|||:||:|.:..:|.......:.|..:|       .....:.
plant   510 SIQLLPAIMHMSNEAGDEGYNIDAVHVAISLVDHSILSEGSGTGRKLSVMD-------ANAEASS 567

  Fly   504 LIRQYVQRF-ERTDTSEALHYY-------------YTLRCLKD-SKGRNMFMACVCDLVV--DSG 551
            :||||...: ...|....|.||             ::.|...| .:.||:.:..:...::  :.|
plant   568 MIRQYGSMYLHHGDLQMTLEYYAQAAIAVGGGQQAWSGRSNVDQQRQRNLMLKQLLTEILSQEDG 632

  Fly   552 VFDTTIFDLIFGKRQSSDQNDVNSGLFRQFECPEFDTR-TMAAQVGDELAALGNFEMSARLYEMA 615
            :      ..:.|.|.|.::.::...|      |:...| ....:...:....|.::.|..|.:..
plant   633 I------HFLLGARGSGEEGELGRFL------PDIKLRQQFLIEAAHQFQEAGLYDKSIELQKRV 685

  Fly   616 GKYNLAVKHI--CILMAQVVHLPTLGGSLRERLGQDAQRFNQLLASDSI--------DVEPK--- 667
            |.::.|::.|  |:..|       :...:|.|...:::....:|:.:.|        ||..:   
plant   686 GAFSSALETINKCLSEA-------ICSLVRGRPDGESRTEGLVLSGNDILNSYKYHPDVSAQERH 743

  Fly   668 -MKSSFVLLQDLLIFFNFYHDGKFNAALDLLRQTQLVPNT-LD--DVDVVLGNVKQLSGEVIKVL 728
             :.....:|::|....:.:...:.|..||.:|:...:|.. ||  ..|......::.|......:
plant   744 LVMEQETILRELEAILSIHKLARLNKHLDAIREVAKLPFLHLDPRQPDTTSDEFQKASSYFQTCV 808

  Fly   729 PDVIVAAM 736
            ||::..|:
plant   809 PDLLKVAL 816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 12/73 (16%)
Nic96 213..781 CDD:282017 126/610 (21%)
AT3G57350NP_191294.5 Nic96 246..849 CDD:282017 126/610 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H40971
Inparanoid 1 1.050 91 1.000 Inparanoid score I2199
OMA 1 1.010
OrthoDB 1 1.010 D187731at2759
OrthoInspector 1 1.000 T32329
orthoMCL 1 0.900 OOG5_129616
Panther 1 1.100 LDO PTHR11225
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.