DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and nup93

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_998879.1 Gene:nup93 XenbaseID:XB-GENE-5823109 Length:820 Species:Xenopus tropicalis

Alignment Length:828 Identity:298/829 (36%)
Similarity:460/829 (55%) Gaps:53/829 (6%)


  Fly     6 LLQRAQNLNNDAKAECELPAVERTLQQVLRATTELHSR-VTQTG--CKEIQAHILLGSKGVDLPK 67
            |||:|:.|..:.:...|||.|||.||::.:|...|.|: :|:|.  ...::|.:||||:|:|:..
 Frog     9 LLQQAEQLAAETEGVTELPHVERNLQEIQQAGERLRSKTMTRTSQESANVKASVLLGSRGLDISH 73

  Fly    68 LNQKLEALSARKTFEPLDVKADTDVRTFLKNERENAILSVIEDTKKNISDSANKQRWASMNKVWN 132
            ::|:||:|||..|||||:...|||::.|||||::||:||.||:::|.....|.:....||...|.
 Frog    74 ISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFVMAEEYHRESMLVEWE 138

  Fly   133 EEKTRLLDALIAPSQNFIDLQRLPEPTIVNPLCQP-RSCLDPLELVYAQELRHYNELLLKSSHRP 196
            :.|.|:|..|:|..::.:|..:..|.:.::....| ||.||.:|:.||:::..|||.::....:|
 Frog   139 QVKQRVLHTLLASGEDALDFTQESETSYISESGAPGRSSLDNVEMAYARQIYMYNEKVVSGHLQP 203

  Fly   197 NLVQKFAHLSQSFGDCRLTDMWTLLACVTQISEPLRSDPIKSR---QQRPEFVTYAKSYLERRYR 258
            :||:.....::...|..::|:|.::..:|.:.....||.:|||   |.:..|:..|..:||:.|:
 Frog   204 SLVELCTEAAERLDDKNVSDLWVMVKQMTDVPLIPASDSLKSRCSVQMQMAFLRQALHFLEQSYK 268

  Fly   259 VFMC---------SQVGGSYANNSYQLVVAYVNHRFRAQQTIGLVD-TVREIPLWPLVYYGLRCG 313
            .:..         :|:||  ...:|.||.:::|.|..| ...||.| .|...|:|.|:||.:|||
 Frog   269 NYTLMSVFANLQQAQLGG--VPGTYNLVRSFLNIRLPA-PIPGLQDGEVEGYPVWALIYYCMRCG 330

  Fly   314 AVKVAVEFLREA----GSSHDEFAQLV--ADRNAGETNSKIENQLRLQYANKIRNSTDAYKKAVY 372
            .:..|.:.:..|    |...:.|.:.|  .||....|.   ||:|||.|...:|.|||.||:.||
 Frog   331 DLMAAQQVVNRAQHQLGDFKNCFQEYVHSKDRRLSPTT---ENKLRLHYRRAVRASTDPYKRVVY 392

  Fly   373 CILLGCDVNEVHGEVAKTIDDFLWMRLAMI--------QPGDADNYGKLQSMILEQYGEKYFNAR 429
            ||:..|||.:.|.|||...:|:||::|:.:        .|.|.....:.|..:.|.|||.:|...
 Frog   393 CIIGRCDVTDNHSEVADKTEDYLWLKLSQVCFEDEANSSPQDRLTLPQFQKQLFEDYGESHFAVN 457

  Fly   430 QQPYLYFETLALTGQFEAAIEFLARQDENRAHAVHMAIALFELGLLGSARSVSQPLLSIDIKDPQ 494
            |||||||:.|.||.||||||.||.|.:..|.||||:|:|||||.||..:...|..|||::..|||
 Frog   458 QQPYLYFQVLFLTAQFEAAIAFLFRLERTRCHAVHVALALFELKLLLKSTGQSAQLLSLEPGDPQ 522

  Fly   495 PLRRLNLTRLIRQYVQRFERTDTSEALHYYYTLRCLKDSKGRNMFMACVCDLVVDSGVFDTTIFD 559
            .:|.||..||:..|.::||.||..|||.|:|.||..|||:|.:||:.||.:||::|     ..||
 Frog   523 GVRHLNFIRLLMLYTRKFEPTDPREALQYFYFLRNEKDSQGESMFLRCVSELVIES-----REFD 582

  Fly   560 LIFGKRQSSDQNDVNSGLFRQFECPEFDTRTMAAQVGDELAALGNFEMSARLYEMAGKYNLAVKH 624
            ::.||.:.....  ..|...:|   ..||:|:..:|.......|.||.:|:||::|...:..::.
 Frog   583 MLLGKLEKDGSR--KPGAIDKF---TRDTKTIINKVASVAENKGLFEEAAKLYDLAKNPDKVLEL 642

  Fly   625 ICILMAQVVHLPTLGGSLRERLGQDAQRFNQLLASDSIDVEPKMKSSFVLLQDLLIFFNFYHDGK 689
            ...|::.||...:...|.||||...|....:...|..:..|..:.|:|.||.||:.||:.||.|.
 Frog   643 TNKLLSPVVSQISAPQSNRERLKNMALAIAERYKSQGVSAEKSINSTFYLLLDLITFFDEYHAGH 707

  Fly   690 FNAALDLLRQTQLVPNTLDDVDVVLGNVKQLSGEVIKVLPDVIVAAMEIAQKQYKQLKAGSGSSL 754
            .:.|.|::.:.:|||.:.|.|:..:...:..|.|:...|.::::|.|.|...|||:||....::|
 Frog   708 VDLAFDVIERLKLVPLSQDSVEERVAAFRNFSDEIRHNLSEILLATMNILFTQYKRLKGSGPNTL 772

  Fly   755 EQTQMQQ------LRQRAKALSNMAATMPYRLPNDTNKRLIELELDMH 796
            .:.|..|      ||.:|:||...|..:|||:..|||.||:::|:.|:
 Frog   773 GRPQRAQEDKDSVLRSQARALITFAGMIPYRMSGDTNARLVQMEVLMN 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 15/60 (25%)
Nic96 213..781 CDD:282017 214/601 (36%)
nup93NP_998879.1 Nic96 220..805 CDD:282017 214/601 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C308326945
eggNOG 1 0.900 E1_KOG2168
Hieranoid 1 1.000
Homologene 1 1.000 H40971
Inparanoid 1 1.050 472 1.000 Inparanoid score I1365
OMA 1 1.010
OrthoDB 1 1.010 D187731at2759
OrthoFinder 1 1.000 FOG0002843
OrthoInspector 1 1.000 T601597
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R780
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.