DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and Nup93-1

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_572929.1 Gene:Nup93-1 FlyBaseID:FBgn0027537 Length:823 Species:Drosophila melanogaster

Alignment Length:829 Identity:372/830 (45%)
Similarity:540/830 (65%) Gaps:39/830 (5%)


  Fly     1 MDLNTLLQRAQNLNNDAKAECELPAVERTLQQVLRATTELHSRVTQTGCKEIQAHILLGSKGVDL 65
            |||..||::||.|.|:...:.|:|.||||:.|||:||.|.||||||.|..::|||||||||||||
  Fly     1 MDLMELLKQAQRLTNETNTDTEVPGVERTMSQVLQATKEFHSRVTQMGTNDLQAHILLGSKGVDL 65

  Fly    66 PKLNQKLEALSARKTFEPLDVKADTDVRTFLKNERENAILSVIEDTKKNISDSANKQRWASMNKV 130
            |||.||||:||||:||||:|...:|:|:.:|||||||||||||::|.::|..|..:|:|..:...
  Fly    66 PKLTQKLESLSARQTFEPIDPVTETNVQAYLKNERENAILSVIDETNRSIFKSVERQKWRCIYSE 130

  Fly   131 WNEEKTRLLDALIAPS-QNFIDLQRLPEPTIVNPLCQPRSCLDPLELVYAQELRHYNELLLKSSH 194
            |.|||..||:||:.|: |:|.|:|....||.:.....|.|.|:..|.:||:::..:|:.:: ...
  Fly   131 WGEEKEALLNALVGPNQQDFPDVQFQIVPTAMADEPTPYSQLNGHEQMYAEQIAIHNQSII-LGR 194

  Fly   195 RPNLVQKFAHLSQ-SFGDCRLTDMWTLLACVTQISEPLRS--DPIKSRQQRPEFVTYAKSYLERR 256
            ||||:...||:.| ||.|..:.:||.:|..:|.: .|:.|  ||||:||..|:||..|::|||||
  Fly   195 RPNLLSTLAHVVQDSFNDESVAEMWNVLQFMTAL-PPVSSTIDPIKNRQTSPQFVEQARTYLERR 258

  Fly   257 YRVFMCSQVGGSYAN-------NSYQLVVAYVNHRFRAQQTI-GLVDTVREIPLWPLVYYGLRCG 313
            ||.:|...:..:.|.       :.|.:|.:||....:.|:.: ||.|.....||||.|||.||.|
  Fly   259 YRTYMRKFIVANLAKARRGGIPSVYHMVRSYVGVTLQGQRALYGLHDVNNGQPLWPHVYYSLRSG 323

  Fly   314 AVKVAVEFLREAGSSHDEFAQLVADRNAGETN--SKIENQLRLQYANKIRNSTDAYKKAVYCILL 376
            .:..|..:|:|:|:..|....|...:|....|  .|:|.||:|:|.:::|..||.||||||.:||
  Fly   324 DMDAAALYLKESGTCPDLLTLLTLRKNGDRDNLMVKLEGQLKLEYNSRLRACTDPYKKAVYVVLL 388

  Fly   377 GCDVNEVHGEVAKTIDDFLWMRLAMIQPGDADN-------YGKLQSMILEQYGEKYFNARQQPYL 434
            .||.:..|.|:.::|||||||:|::::..|..:       :..|||:|||:|||.|||||::..|
  Fly   389 ACDPHFTHVELMRSIDDFLWMQLSILRRSDQSDSNTEQLTFSGLQSLILEKYGENYFNAREKAAL 453

  Fly   435 YFETLALTGQFEAAIEFLARQDENRAHAVHMAIALFELGLLGSARSVSQPLLSIDIKDPQPLRRL 499
            ||:.|.||||||||||||||.::||.||:||||||.|:.:||:.|||.|.|||.|..||:|::||
  Fly   454 YFQVLTLTGQFEAAIEFLARTEKNRTHAIHMAIALNEISMLGTPRSVEQSLLSSDPDDPKPMKRL 518

  Fly   500 NLTRLIRQYVQRFERTDTSEALHYYYTLRCLKDSKGR-NMFMACVCDLVVDSGVFDTTIFDLIFG 563
            ||.|||..|.:.||||||::||||||.||..|...|| |:.:.|||||:|:.  .|..:.:||||
  Fly   519 NLVRLIVMYTKCFERTDTTQALHYYYLLRNFKSENGRGNVMLTCVCDLLVEK--CDDEMLELIFG 581

  Fly   564 KRQSSDQNDVN-SGLFRQFECPEFDTRTMAAQVGDELAALGNFEMSARLYEMAGKYNLAVKHICI 627
            ....  :|.:. .|::.:|:..|.|..::|..|||||:..|::|::..||.:.|:.:.|::.:..
  Fly   582 TEDK--KNGLRYGGIYAEFQIHECDKYSLAEMVGDELSKRGDYELAIELYFIGGQLDKALRLVNS 644

  Fly   628 LMAQVVHLPTLGGSLRERLGQDAQRFNQLLASDSIDVEPKMKSSFVLLQDLLIFFNFYHDGKFNA 692
            |:|||||.||..||:|.|||....|.:..|.....|||.::..::.:|..::.||:.||:|...:
  Fly   645 LLAQVVHQPTQNGSVRNRLGDIINRLDAALVVRKSDVEVQVVVTYTVLTKVMKFFDHYHEGALRS 709

  Fly   693 ALDLLRQTQLVPNTLDDVDVVLGNVKQLSGEVIKVLPDVIVAAMEIAQKQYKQL----KAGSGSS 753
            ||::|....|:|.:..:||..:.|:|::..||||||||:::|:|:|..::|.:|    :..||..
  Fly   710 ALEILTNNHLIPASSLEVDECVTNIKRMGPEVIKVLPDILLASMDIVYQEYVKLMDSNETASGFF 774

  Fly   754 LE------QTQMQQLRQRAKALSNMAATMPYRLPNDTNKRLIELELDMH 796
            .|      :..::.||.||||.:||||::|||:|:.||:||::||:.||
  Fly   775 DESKCVNKEPAVKHLRDRAKAFTNMAASVPYRMPSTTNQRLVQLEILMH 823

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 23/63 (37%)
Nic96 213..781 CDD:282017 254/599 (42%)
Nup93-1NP_572929.1 Nic96 215..808 CDD:309288 254/598 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C308312632
eggNOG 1 0.900 E1_KOG2168
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2199
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D187731at2759
OrthoFinder 1 1.000 FOG0002843
orthoMCL 1 0.900 OOG5_129616
Panther 1 1.100 P PTHR11225
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R780
87.920

Return to query results.
Submit another query.