DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and nup93

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_571056.2 Gene:nup93 ZFINID:ZDB-GENE-990415-46 Length:820 Species:Danio rerio

Alignment Length:825 Identity:293/826 (35%)
Similarity:461/826 (56%) Gaps:47/826 (6%)


  Fly     6 LLQRAQNLNNDAKAECELPAVERTLQQVLRATTELHSRV---TQTGCKEIQAHILLGSKGVDLPK 67
            |||:|:.|..:.:|..|||.|||.||::.:|...|.||.   |.....:::|.|||||:|:|:..
Zfish     9 LLQQAEQLAAETEAVSELPHVERNLQEIQQAGERLRSRTLTRTSQDTADVKASILLGSRGLDIFH 73

  Fly    68 LNQKLEALSARKTFEPLDVKADTDVRTFLKNERENAILSVIEDTKKNISDSANKQRWASMNKVWN 132
            ::|:||:|||..|||||:...|||::.||||||:||:||.||::::.....|.:....||...|.
Zfish    74 ISQRLESLSAATTFEPLEPVKDTDIQGFLKNERDNALLSAIEESRRRTFLLAEEYHRDSMLVQWE 138

  Fly   133 EEKTRLLDALIAPSQNFIDLQRLPEPTIVNPLCQP-RSCLDPLELVYAQELRHYNELLLKSSHRP 196
            :.|.|:|..|:...::.:|..:..||:.|:.:..| ||.||.:|:.|::::..:||.::....:|
Zfish   139 QVKQRVLHTLLGAGEDALDFSQEVEPSFVSEVGVPGRSALDSVEVAYSRQIYVFNEKIVNGHLQP 203

  Fly   197 NLVQKFAHLSQSFGDCRLTDMWTLLACVTQISEPLRSDPIKSR---QQRPEFVTYAKSYLERRYR 258
            ||....|.:::|..|..:::||.::..:|.:......|.:|||   ..:..||..|..:||..|:
Zfish   204 NLGDLCASVAESLDDKNVSEMWLMVKQMTDVLLVPAKDTLKSRVSVDMQMAFVRQALQFLENSYK 268

  Fly   259 VFMC---------SQVGGSYANNSYQLVVAYVNHRFRAQQTIGLVDTVREIPLWPLVYYGLRCGA 314
            .:..         :|:||  ...:||||.:::|.:............|...|:|.|:|:.||||.
Zfish   269 NYTLVTVFGNLHQAQLGG--VPGTYQLVCSFLNIKLPTPLPGRQDGEVEGHPVWALIYFCLRCGD 331

  Fly   315 VKVAVEFLREAGSSHDEFA---QLVADRNAGETNSKIENQLRLQYANKIRNSTDAYKKAVYCILL 376
            :..|::.:.:|.....:|.   |...:......:...||:|||.|...:|||.|.||:||||::.
Zfish   332 LSAAMQVVNKAQHQLGDFKIWFQEYMNSPDRRLSPATENKLRLHYRRVLRNSADPYKRAVYCLIG 396

  Fly   377 GCDVNEVHGEVAKTIDDFLWMRLAMI--------QPGDADNYGKLQSMILEQYGEKYFNARQQPY 433
            .||:.:.|||||...:|:||::|..:        .|.|.....:||..:||.|||.:|:|..||:
Zfish   397 KCDIGDNHGEVADKTEDYLWLKLNQVCFDEDGSSSPQDRMTLAQLQKQLLEDYGESHFSASHQPF 461

  Fly   434 LYFETLALTGQFEAAIEFLARQDENRAHAVHMAIALFELGLLGSARSVSQPLLSIDIKDPQPLRR 498
            |||:.|.||.||||||.||.|.:..|:||||:|:.|:||.||..:...|..|||.:..||..:||
Zfish   462 LYFQVLFLTAQFEAAIAFLFRVERLRSHAVHVALVLYELKLLLKSSGQSAQLLSQEAGDPPMVRR 526

  Fly   499 LNLTRLIRQYVQRFERTDTSEALHYYYTLRCLKDSKGRNMFMACVCDLVVDSGVFDTTIFDLIFG 563
            ||..||:..|.::||.||..|||.|:|.||..|||:|.||||.||.:||::|     ..||::.|
Zfish   527 LNFIRLLMLYTRKFESTDPREALQYFYFLRNEKDSQGENMFMRCVSELVIES-----REFDMLLG 586

  Fly   564 KRQSSDQNDVNSGLFRQFECPEFDTRTMAAQVGDELAALGNFEMSARLYEMAGKYNLAVKHICIL 628
            :.:.....  ..|:..:|   ..|||.:..:|..|....|.||.:.:|||:|...:..::.:..|
Zfish   587 RLEKDGSR--KPGVIDKF---AGDTRAIITKVASEAENKGLFEEAVKLYELAKNADKVLELMNKL 646

  Fly   629 MAQVVHLPTLGGSLRERLGQDAQRFNQLLASDSIDVEPKMKSSFVLLQDLLIFFNFYHDGKFNAA 693
            ::.|:...:...|.:|||...|....:...::.:..|..:.::|.||.||:.||:.||.|..:.|
Zfish   647 LSPVIAQVSEPQSNKERLKNMAVAIAERYRANGVAGEKSVDNTFYLLLDLMTFFDEYHAGHIDRA 711

  Fly   694 LDLLRQTQLVPNTLDDVDVVLGNVKQLSGEVIKVLPDVIVAAMEIAQKQYKQLK-AGSGS----- 752
            .|::.:.:|||.:.|.|:..:...:..|.||...|.:|::|.|.|...|||:|| |.:|:     
Zfish   712 YDVIERLKLVPLSQDSVEERVAAFRNFSDEVRHNLSEVLLATMNILFTQYKRLKGAAAGTPGRPQ 776

  Fly   753 -SLEQTQMQQLRQRAKALSNMAATMPYRLPNDTNKRLIELELDMH 796
             :||...| .||.:|:||...|..:|||:..|||.||:::|:.|:
Zfish   777 RTLEDRDM-LLRIQARALITFAGMIPYRMAGDTNARLVQMEVLMN 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 14/60 (23%)
Nic96 213..781 CDD:282017 206/598 (34%)
nup93NP_571056.2 GluZincin 4..>127 CDD:301352 54/118 (46%)
Nic96 220..804 CDD:282017 206/597 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C308321613
eggNOG 1 0.900 E1_KOG2168
Hieranoid 1 1.000
Homologene 1 1.000 H40971
Inparanoid 1 1.050 468 1.000 Inparanoid score I1460
OMA 1 1.010
OrthoDB 1 1.010 D187731at2759
OrthoFinder 1 1.000 FOG0002843
OrthoInspector 1 1.000 T597413
orthoMCL 1 0.900 OOG5_129616
Panther 1 1.100 LDO PTHR11225
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R780
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.