DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and npp106

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_588422.1 Gene:npp106 PomBaseID:SPCC1739.14 Length:933 Species:Schizosaccharomyces pombe

Alignment Length:941 Identity:185/942 (20%)
Similarity:365/942 (39%) Gaps:211/942 (22%)


  Fly     3 LNTLLQRAQNLNNDAKAECELPAVERTLQQVLRATTELHSRVTQTGCKEIQAHILLGSKGVDLPK 67
            ::.|.:::|:|.. ...|.::|.::..|.|:......|.|:|..|...:.:||.||...|::..:
pombe    25 ISDLREKSQHLFG-VLLEPQVPVIQYGLNQLEEKARNLESKVLLTRDGDTKAHYLLAESGMNAEQ 88

  Fly    68 LNQKLEALSARKTFEPLDVKADT---DVRTFLKNERENAILSVIEDTKKNISDSANKQRWASMNK 129
            ..||:.::.....::.|::...:   ...|.|.| .:|.:.|:....:.|:.:.  :.|....|.
pombe    89 TRQKIYSIHIHSPWDQLELDKKSLYEQPHTKLYN-GQNVVASIENGYQSNVYEF--QLRLMKNNG 150

  Fly   130 V-WNEEKTRLLD---ALIAPSQNF---IDLQRLPEPTIVNPLCQPRSCLDPLELVYAQELRHYNE 187
            : |...||..::   .|:....|.   ..:.....|.:..||....|       |.:|.:|...|
pombe   151 IAWENTKTEFMEDVGKLLHSKDNSGLGTSISMSLRPNLARPLLTASS-------VKSQSVRSLRE 208

  Fly   188 L----------LLKSSHRPNLVQK------------FAHLSQSF-------GDCRLTD----MWT 219
            :          |.|.....|.:..            ||..:.||       .:.|:.:    :|:
pombe   209 VGSNLPIPTGSLTKIDGLNNQLSNDLTRSQTTNIFGFAEKASSFAAAVHKLNEARIRNQACHVWS 273

  Fly   220 LLACVTQISEPLRSDPI--------------KSRQQRPEF--------------------VTYAK 250
            |.|.|:|:   :.::.|              ::|....:|                    :..:.
pombe   274 LFASVSQM---VNTEVIQLFDAWSLLAHMIDETRYGMGDFEARHLALDSSSAALAVEKNCIEGSL 335

  Fly   251 SYLERRYRVFM---CSQVGGSYANNSYQLVVAYVNHRF--RAQQTIGLVDTVREIPLWPLVYYGL 310
            .|||.::...:   .|..|.....||.:.|:||...||  ........|..|.::|||.:::|.:
pombe   336 KYLENQFLSLIDLHLSDAGHITTVNSVEKVIAYSKLRFYKNGSWIKSTVSVVNDVPLWVVLFYLM 400

  Fly   311 RCGAVKVAVEFLREAGSSHDEFAQL----------VADRNAGETNSKIENQLRLQYANKIRNS-T 364
            |.|.:..|::|:   .:..|:|.:|          .|...:.....::.::|:.:|...::.: .
pombe   401 RSGQLDAALQFV---NTYSDDFEKLGRSFPLYFYSYAKNPSLPLPKQLRDRLQAEYGQLMKYAPE 462

  Fly   365 DAYKKAVYCILLGCDVNEVH-GEVAKTIDDFLWMRLAMIQPGDAD--------------NYGKLQ 414
            |.:|.|:|.:|..|:.:.|. .||..|.:|::|::|...:....|              |..:|:
pombe   463 DPFKHAIYKLLGNCEPHRVSLPEVCVTSEDYMWIQLMFCRVNQNDVIDSNGGQSTNSLFNLYQLE 527

  Fly   415 SMILEQYGEKYFNARQQ-PYLYFETLALTGQFEAAIEFLARQDENRAHAVHMAIALFELGLLGSA 478
            ..|: .:|.:|||.:.. |..||..|.:.|:||.||.||  .......|.|.|:|:...|||.:.
pombe   528 KKIV-AFGPRYFNPKNNTPTNYFLALLMCGEFERAISFL--HTNYPVEATHFAVAMAYYGLLRTK 589

  Fly   479 R-SVSQPLLSIDIKDPQPLRRLNLTRLIRQYVQRFERTDTSEALHYYYTLRCLKDSKGRNMFMAC 542
            . ..::.:|..:..|.    ::|..:||..|::..|..|.:..|.|   :.|:.....   :.||
pombe   590 NYEKNENILIYEADDV----KINFPQLIIAYLKHLEYVDAAVYLDY---IACIPLVPA---YQAC 644

  Fly   543 VCD----LVVDSGVFDTTIFDLIFGKRQSSDQNDVNSGLFRQF-ECPEFDTRTM-------AAQV 595
            ..:    |::.|..|...:.|:       ....:..:||...: ....||..::       |.:.
pombe   645 SINLTKILLLQSHEFSKFLGDI-------KPDTERTTGLLDLYLRLIPFDHDSLQKLYLEGAREA 702

  Fly   596 GDELAALGNFEMSARLYEMAGKYN----LAVKHICILMAQVVHLPTLGGSLRERLGQDAQRFNQL 656
            .|:    |.|..|..||.:.|.|:    :|:|:    ::|.:....| .|:..:..::....:.:
pombe   703 DDD----GRFGDSIILYHLLGDYDTVIGVAIKN----LSQSIVSRGL-WSIDSKESKNMHISSNV 758

  Fly   657 LASDSIDV-----------EPKM--------KSSFVLLQDLLIFFNFYHDGKFNAALDLLRQTQL 702
            :||::.|.           .||.        |.:..:|..::.....|...|::..|.|:....|
pombe   759 VASEAPDALAANLLAMYESNPKKSAKVSATNKKALKVLLKVVKVQKLYGQEKWDEVLQLIEHLDL 823

  Fly   703 VPNTLDDVDVVLGNVKQL-----------------SGEVIKVLPDVIVAAMEIAQKQYKQL-KAG 749
            :|  :::|.......:|:                 ..||:.|:|.::..:|...:..|:.: |..
pombe   824 LP--INEVQAEFEPNEQIPPISARLRRRAFEFSTFQDEVLSVIPSLMYISMSSIKALYRTISKLP 886

  Fly   750 SGSSLEQTQMQQLRQRAKALSNMAATMPYRL 780
            ..:...:.::|:|:.:...|...:..:..||
pombe   887 VVNEESKKKLQRLQFKGSMLVMFSTMIESRL 917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 17/107 (16%)
Nic96 213..781 CDD:282017 138/693 (20%)
npp106NP_588422.1 Nic96 288..918 CDD:282017 131/665 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1310
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002843
OrthoInspector 1 1.000 T133360
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11225
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R780
TreeFam 1 0.960
88.050

Return to query results.
Submit another query.