DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup93-2 and nup97

Sequence 1:NP_650404.1 Gene:Nup93-2 FlyBaseID:FBgn0038274 Length:796 Species:Drosophila melanogaster
Sequence 2:NP_588469.1 Gene:nup97 PomBaseID:SPCC1620.11 Length:851 Species:Schizosaccharomyces pombe

Alignment Length:903 Identity:212/904 (23%)
Similarity:371/904 (41%) Gaps:187/904 (21%)


  Fly     8 QRAQNLNNDAKAECELPAVERTLQQVLRATTELHSRVTQTGCKEIQAHILLGSKGVDLPKLNQKL 72
            |:::.|.|:....| ||.::..|.::.:......:.|..:.....:||.||...|::..:..:|:
pombe    20 QKSRKLANELLEPC-LPFIQFNLGEIEQRAKHYLNTVPTSKDGNTKAHYLLAGSGINAEQTWKKI 83

  Fly    73 EALSAR----KTFEPLDVKADTDVRTFLKNERENAILSVIEDTKKNIS---DSANKQRW------ 124
            |:||.:    .|.|    .:.|||..|||..||..:|:.:|...:|..   |...::.|      
pombe    84 ESLSLQVRPPTTLE----LSFTDVDMFLKYHREKNVLNSLEALVQNTQIAFDQYLEEEWRSKAAK 144

  Fly   125 --ASMNKVWNEEKTRL--LDALIAPSQNFIDLQRLPEPTIVNPLCQPRSCLDPLELVYAQELRHY 185
              .|.:.:..|.|.|:  ....:..||.|....::              ||:       :|..|.
pombe   145 SRPSFDNILLENKKRVSFYPFSVQRSQKFASTLKM--------------CLE-------EEALHG 188

  Fly   186 NELLLKSSHRPNLVQKFAHLSQSFGDCRLTDMWTLLACVTQISEPL-----------------RS 233
            .:..|.||. ..:.::|||.::|.   .|.:.|.||:.|....:.:                 ..
pombe   189 FQSKLVSSF-CEVAREFAHDTKSL---LLYESWKLLSSVILDKDSVTVFGNKGIISKAFDIETED 249

  Fly   234 DPIKSR-QQRPEFVTYAKSYLERRY---------RVFMCSQVGGSYANNSYQLVVAYVNHRFRAQ 288
            ..:.|| .||  ....::.:||.::         :....:.|||          |..:.::.||.
pombe   250 GSVNSRFYQR--ISDCSRKFLEAQFFEVLNKEIAKTPQAALVGG----------VPSIRNKIRAY 302

  Fly   289 QTIGL----------VDTVREIPLWPLVYYGLRCGAVKVAVEFLREAGSSHDEFAQ---LVADRN 340
            ..|.|          ::.::::|:|..::|.||||.:|.||:|..|.....::.|:   ...:..
pombe   303 LNIRLLRNGVWINPDLEIIQDVPIWAFIFYLLRCGFLKEAVDFTEENRDLFEKVAEKFPFYINAY 367

  Fly   341 AGETNSKIENQLRLQYAN------KIRNSTDAYKKAVYCILLGCDVNEVH-GEVAKTIDDFLWMR 398
            |...|..:..|||.|..:      :::.|:|.||.|||.|:..||:::.. ..:....:|::|.:
pombe   368 AKAPNGILPRQLRSQLFSEFNQTIRLQESSDPYKYAVYKIIGRCDLSKTSCPSICSVTEDYIWFQ 432

  Fly   399 LAMI-----QPGDADNYGKLQSM--ILEQYGEKYF-NARQQPYLYFETLALTGQFEAAIEFLARQ 455
            |.:.     :...|..:..|:.:  ||..||..|| |....|.:||..|.|.|.:|.||.||  .
pombe   433 LILSREFTEKSVSAHEFFSLEDVQHILLSYGSDYFTNNGSNPVMYFFLLMLCGLYERAINFL--Y 495

  Fly   456 DENRAHAVHMAIALFELGLLGSARSVS---------QPLLSIDIKDPQPLRRLNLTRLIRQYVQR 511
            ......|||.||.....|||.:|.|.|         |.:| ::.|..:|  .|...||:..|.|.
pombe   496 PYFPTDAVHFAITCAYYGLLRTAPSSSVVSNEPGKIQSML-VETKSGKP--SLEFDRLLIDYTQT 557

  Fly   512 FERTDTSEALHYYYTLRCLKDSKGRNMFMACVCDLVVDSGVFDTTIFDLI-FGKRQSSDQNDVNS 575
            .:  :.|..:...|.:...|..|..:|....:|.||:.:..:...:.|:. .|:|..|...:..|
pombe   558 CQ--ELSPVMSACYLIPMCKIDKYISMCHKSLCSLVLSTRDYVNLLGDIRGDGERTPSFLENHRS 620

  Fly   576 --GLFRQFECPEFDTRTMAAQVGDELAALGNFEMSARLYEMAGKYNLAVKHICILMAQVVHLPTL 638
              ||....|.....|.|.|.|..|:    |....:..||.:|..|:.||..|             
pombe   621 LIGLSSVKEYLSKITLTAAKQADDQ----GLLSDAILLYHLAEDYDAAVTVI------------- 668

  Fly   639 GGSLRERLGQDAQRF-NQLLASDSI--------DVEPKMKSSFVLLQ-------DLLIF----FN 683
                ..|||....|| :|.:..|.:        ||..:..|.:..:.       :||:.    ||
pombe   669 ----NRRLGSALLRFLDQFVFPDKLISLTKSMMDVYNRNPSLYAKVDYKNRETTNLLLLTVEAFN 729

  Fly   684 FYHDGKFNAALDLLRQTQLVPNTLDDVD------VVLGNVKQ---LSGEVIKVLPDVIVAAMEIA 739
            .|.:..:..||..|:|.:::|  ||.:|      ||....|:   |:..:::.:|.:::.||...
pombe   730 AYTNKDYEQALSSLQQLEILP--LDPLDSDCETFVVRKLAKEFRFLNENLLQNVPGIVLIAMNSL 792

  Fly   740 QKQYKQLKAGS--GSSLEQTQMQQLRQRAKALSNMAATMPYRLPNDTNKRLIELELDM 795
            ::.|.:.|:.|  ..::...:::..||:|:.:...:..:.||:|:...::|...|::|
pombe   793 KELYAKQKSSSFGNDAISVDKLRLYRQKARRIVMYSFLIEYRMPSQILEQLNRCEIEM 850

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup93-2NP_650404.1 DUF2461 178..>238 CDD:295279 14/77 (18%)
Nic96 213..781 CDD:282017 158/666 (24%)
nup97NP_588469.1 Nic96 213..836 CDD:282017 158/665 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H40971
Inparanoid 1 1.050 146 1.000 Inparanoid score I1310
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002843
OrthoInspector 1 1.000 T133360
orthoMCL 1 0.900 OOG5_129616
Panther 1 1.100 LDO PTHR11225
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R780
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.