DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14853 and ERICH2

DIOPT Version :10

Sequence 1:NP_650376.1 Gene:CG14853 / 41771 FlyBaseID:FBgn0038246 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001276959.1 Gene:ERICH2 / 285141 HGNCID:44395 Length:436 Species:Homo sapiens


Alignment Length:135 Identity:45/135 - (33%)
Similarity:65/135 - (48%) Gaps:24/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SASSEDLSQSLSEYTDADE------SVSAPTEFLAEFLSAVMLKDYKKALKYCKLILQYEPDNAT 141
            |.|:||..:..:...|.||      :..||.|.:||||.|.|.::|:.|.|.|::||.|||:|..
Human   317 SESAEDDGEDDTNDEDDDEDSNPKKNTQAPLELMAEFLRAEMAREYQLAKKLCQMILIYEPENPE 381

  Fly   142 AKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHASDVEADVDGDEAGDADE---DGDADA 203
            ||||:.||.:.|....|.:...:..|.               :.|..|:..|::||   |..:|.
Human   382 AKEFFTLIEEMLLMEKTQNHEQDGENS---------------DEDSSGESKGESDEELSDESSDE 431

  Fly   204 DGDGS 208
            ..|||
Human   432 GEDGS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14853NP_650376.1 Fis1 <119..153 CDD:451380 16/33 (48%)
ERICH2NP_001276959.1 PHA03247 <34..145 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.