DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp313a1 and CYP26C1

Sequence 1:NP_650368.1 Gene:Cyp313a1 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_899230.2 Gene:CYP26C1 HGNCID:20577 Length:522 Species:Homo sapiens

Alignment Length:517 Identity:115/518 (22%)
Similarity:205/518 (40%) Gaps:101/518 (19%)


  Fly     1 MLTINLLLAVGALFW-IYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTKYLNK 64
            :|...|||::....| :.::.||.|...|.|. .|.:|.|..|.:|..::...|   |.:....:
Human    19 LLCAGLLLSLAQHLWTLRWMLSRDRASTLPLP-KGSMGWPFFGETLHWLVQGSR---FHSSRRER 79

  Fly    65 YGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGK-QDPHWLDRRK 128
            ||:...|.:...|.|.....:.|..|........:||...:|......:.|||. .:||   ||:
Human    80 YGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGEPH---RRR 141

  Fly   129 HFNPSFKQDLLLSFFHIFDAETKVLMNL-----LDTYVDK----------------GEIDVVPEM 172
            .                     |||..:     |:.||.:                |.:.|....
Human   142 R---------------------KVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVSVYDAS 185

  Fly   173 LRWSFKIAAQTTMGSEVKHDEHFKNGSLVESFESLISH-STLNILMPLVQNRMISKICGYDK-LR 235
            ...:|::||:..:|  ::.|| .:..:|..:||.|:.: .:|.:.:|         ..|..| :|
Human   186 KALTFRMAARILLG--LRLDE-AQCATLARTFEQLVENLFSLPLDVP---------FSGLRKGIR 238

  Fly   236 ADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYD 300
            |.:  ::.:.|:..:::|::.....:.....:::|:.|.||..:..:  .::|.....::.|.:.
Human   239 ARD--QLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHEPSM--QELKESAVELLFAAFF 299

  Fly   301 TSALTVYHALFLLANHPEHQEAVFEEL-------------------NGVFPDAGHFGITYPDMQ- 345
            |:|......:.||..||.....:.|||                   .|..||.|    ..||:. 
Human   300 TTASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPPDCG----CEPDLSL 360

  Fly   346 ----KLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPD 406
                :|.|::.|:||.|||:|.:....|.......| :|..||||..:...:..||....|:...
Human   361 AALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFEL-DGYQIPKGWSVMYSIRDTHETAAVYRSP 424

  Fly   407 ADNFNPDNFLAENMEQK---HPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTST 465
            .:.|:|:.|.|...:.:   ..:.||||..|.|:|:|.:.|....:.....::|..:...:|
Human   425 PEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELAT 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 104/481 (22%)
CYP26C1NP_899230.2 p450 40..504 CDD:299894 110/497 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.