DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp313a1 and LOC100912471

Sequence 1:NP_650368.1 Gene:Cyp313a1 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_006241159.1 Gene:LOC100912471 RGDID:6486508 Length:353 Species:Rattus norvegicus

Alignment Length:281 Identity:82/282 (29%)
Similarity:137/282 (49%) Gaps:28/282 (10%)


  Fly   199 SLVESFESLISHSTLNILMPL-------VQNRMISKICGY----------DKLRADNFSRIQKML 246
            |.:....|||...:..:.:.|       ...|...|.|..          ::.|..:...:.:.|
  Rat    50 SAILELSSLIIKRSQQLFLYLDFLYYRTADGRRFRKACDLVHNFTDAVIRERRRLLSSQGVDEFL 114

  Fly   247 DNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYDTSALTVYHALF 311
            ::....|...|...|       |:..|.:.:.| :::..|:::|....:..|:||:|..:...|:
  Rat   115 ESKTKSKSKTLDFID-------VLLLAKDEHGK-ELSDEDIRAEADTFMFGGHDTTASALSWILY 171

  Fly   312 LLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRL-IPAIPITARETKNDV 375
            .||.|||:||...:|:..:..|.....|.:.|:.:|.:|...|||:||| .|||.:..|.|: |:
  Rat   172 NLARHPEYQERCRQEVWELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPAIDLLRRCTQ-DI 235

  Fly   376 RLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGKRNCIG 440
            .|.:|.:||||.:..|.:|..|.||.|| ||.:.|:|..|.:||.:::.|.::|||:.|.|||||
  Rat   236 VLPDGRVIPKGNICVISIFGIHHNPSVW-PDPEVFDPFRFDSENRQKRSPLSFIPFSAGPRNCIG 299

  Fly   441 SKYAMMSSKFALCRILRNYKI 461
            ..:||...|..:...|..:::
  Rat   300 QTFAMNEMKVVVALTLLRFRV 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 82/282 (29%)
LOC100912471XP_006241159.1 p450 <1..343 CDD:278495 82/282 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.