DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(Hw) and CG15269

DIOPT Version :10

Sequence 1:NP_524349.1 Gene:su(Hw) / 41740 FlyBaseID:FBgn0003567 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster


Alignment Length:240 Identity:81/240 - (33%)
Similarity:113/240 - (47%) Gaps:21/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 THSEFSDFPCSICNANLRSEALLALHEEQHKSRGKPYACKICGKDFTR----SYHLKRHQKYSSC 372
            |.:|...:.|.||.........|..||:.|||  ..|.|..|||.|::    .|||..|:     
  Fly   291 TSAEEISYKCRICEKVFGCSETLQAHEKTHKS--PRYECADCGKGFSQLRNYKYHLSVHR----- 348

  Fly   373 SSNETDTMSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHTG 437
             ..:.....|..|.:.|.....|.||||.|.     .:.||.|..|...|......|:|:|.|||
  Fly   349 -GTKEFAAECPECGKTFNDKGYLSSHLKIHR-----NRKEYECPYCPKSFNQRVAFNMHVRIHTG 407

  Fly   438 EKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHKCDEC 502
            .||..|:.|.|:||..:.||:|.|.|:|||||.|:||.::||.:..:..|.:.|:|.:|..|..|
  Fly   408 VKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLC 472

  Fly   503 GKSFIQATQLRTHSKTH--IRPFPC--EQCDEKFKTEKQLERHVK 543
            .|:|.:...|:||...|  .:|:.|  ..|::.|.....:..|.|
  Fly   473 PKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK 517

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity