DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG14354

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster

Alignment Length:271 Identity:96/272 (35%)
Similarity:147/272 (54%) Gaps:40/272 (15%)


  Fly    10 LIIVLSSLPA-----SATGNHYRTRRKPMQTEDSDLMRSFAGGLGGGGPGDGTVCDMSGEDSNSP 69
            |:::.|||.|     |:...:.:..|..:..:.:||......|                      
  Fly    17 LLMISSSLAACYQRHSSCPQNQQQSRSQLLDQSADLTMGIRQG---------------------- 59

  Fly    70 AKKTRNHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAAAKAAEAVLFGK 134
                    |:||.:|.||.:||.|||||:|....|...||.::|.:.|:||.||||||||.|.||
  Fly    60 --------NSKQTASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLAEKAIAAAKAAEAALAGK 116

  Fly   135 SQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQELKTLTISLKLAKDIKDASDQ 199
            .|::|||:.||.|||::||||...|:.:::|..:|..|.:..|..|::|..|:|:|::....::.
  Fly   117 QQLMEQLQDEVHEAEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQSLRSSVKVAEEAVSNAEA 181

  Fly   200 VYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAKAAQEAKQRI--DQSEC 262
            ..:..||.|.:|..|:|.|::|..:||:||..|:|||..|:|||..||.||.||:.:.  |:...
  Fly   182 AASGAQQELCEKNQLVETARQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANEARNKAVRDRRSY 246

  Fly   263 E---GGSRGRR 270
            |   ||:.|::
  Fly   247 EEDIGGTFGQQ 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 71/160 (44%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 82/210 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.