DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG14841

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650350.1 Gene:CG14841 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster

Alignment Length:258 Identity:95/259 (37%)
Similarity:133/259 (51%) Gaps:32/259 (12%)


  Fly    10 LIIVLSSLPASATGNHYRTRRKPMQTEDSDLMRSFAGGLGGGGPGDGTVCDMSGEDSNSPAKKTR 74
            :|::..|.|..|  ..|....:..||             ..||..:|  |:.|....||.....:
  Fly    33 IIMISDSDPVVA--RLYEPASEKKQT-------------ASGGSSEG--CETSSAVQNSCGLSQK 80

  Fly    75 NHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAAAKAAEAVLFGKSQVLE 139
               |||.::|.||::||.:||.|||....|.:.|:.::|.:.|:||..||:||||.|.||.|::|
  Fly    81 ---NAKSKASSIAIKAAQDAKAANDAQMAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIME 142

  Fly   140 QLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQELKTLTISLKLAKDIKDASDQVYTV- 203
            |||.|.:||..||.|....|.:.:.||:.|    .|...|.|.....||:.  :.:|:.|:..: 
  Fly   143 QLELEEKEAVAVVDEVKNSLHSTQVNAESA----MLAFSEAKIQLDQLKVL--LAEATAQMTNIE 201

  Fly   204 -----WQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAKAAQEAKQRIDQSE 261
                 .|..:.:|..|||||.|||..:.||:..||.|||||||||..||.||.||||:..:.:
  Fly   202 TFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAACAAVEAKQKAQRMQ 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 66/166 (40%)
CG14841NP_650350.1 DUF745 81..260 CDD:283087 81/185 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.