DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG14840

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster

Alignment Length:272 Identity:105/273 (38%)
Similarity:146/273 (53%) Gaps:26/273 (10%)


  Fly     5 TQIMWLIIVLSSLPASATGNHYRTRRKPMQTEDSDLMRSF-----------AGGLGGGGPGDGTV 58
            |:.:.|:::|..........|||    |.:|.|...:.:.           |||||||..|.|..
  Fly     4 TKALLLVLLLLRAFPRLESYHYR----PAETNDKQCLSALYGDASIDGTGGAGGLGGGSEGCGEP 64

  Fly    59 CDMSGEDSNSPAKKTRNHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAA 123
            ....|...:| ........:.||::|.||.:||.|||.|:|....|.:.||.::|.|.|.||..:
  Fly    65 NSKKGVGCSS-GTGVFGRGDPKQKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQS 128

  Fly   124 AKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAK-THQLVQQ--ELKTLTI 185
            |:||||.|.||.|::|||:.|:.||:.||.|....|...::||..||. .|:...|  :||.|.|
  Fly   129 ARAAEAALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVI 193

  Fly   186 SL--KLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAK 248
            :.  .||.     .:.|.:..||.||:||.|||||:.||..|.||::||:.|::|||:||..||.
  Fly   194 AATSNLAN-----IENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAAC 253

  Fly   249 AAQEAKQRIDQS 260
            ||.||||:..:|
  Fly   254 AAVEAKQKAQRS 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 71/165 (43%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 84/185 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.