DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG11698

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649787.2 Gene:CG11698 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster

Alignment Length:266 Identity:76/267 (28%)
Similarity:122/267 (46%) Gaps:55/267 (21%)


  Fly     1 MRIDTQIMWLIIVLSSLPASATGNHYRTRRKPMQTEDSDLMRSFAGGLGGGGPGDGTVCDMSGED 65
            ||.|:.:..|:  ||::..|       |...|.|..|....           ||           
  Fly     8 MRCDSLVTMLL--LSNILLS-------TAAHPAQRNDPRFK-----------PG----------- 41

  Fly    66 SNSPAKKTRNHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAAAKAAEAV 130
             :.|.|       ...::|.:|.:||.:||.|.|....|.:.|..:.:...||:|..|||||||.
  Fly    42 -SLPCK-------TSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAA 98

  Fly   131 LFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAK--------THQLVQQELKTLTISL 187
            |.||.|:|::....:.|...|: ||.|..|.|.|.:..:||        :..:::..||.:..:|
  Fly    99 LNGKKQLLDEYTKSLAETNRVI-EEIQRAIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNL 162

  Fly   188 KLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAKAAQE 252
            ...:.:.|::       |:...:|.:||:||:.||..|...:.||:.|.::.|::|..|..||:|
  Fly   163 DNIRRMADSA-------QKEALEKRSLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDAAKE 220

  Fly   253 AKQRID 258
            |:|||:
  Fly   221 AQQRIE 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 51/168 (30%)
CG11698NP_649787.2 DUF745 45..225 CDD:283087 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.