DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG11694

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster

Alignment Length:233 Identity:99/234 (42%)
Similarity:136/234 (58%) Gaps:22/234 (9%)


  Fly    52 GPGDGTVCDMSGEDSNSPAK-KTRNHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGE 115
            |.||.:|...||   .:|.. |....|..|  :|.||.:||.||.:|:|....|.:.||.::|.:
  Fly    39 GDGDNSVSSSSG---GAPCDFKMNGKTRVK--ASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQ 98

  Fly   116 YADKANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQEL 180
            .||||.||||||||.|.||.|::||||:||||.|:|||||:..|.|.::....|.:..:....:|
  Fly    99 LADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQL 163

  Fly   181 KTLTISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALS 245
            .|:|:::|.|:|....|:.|.:..||.|.:|..|:|||::||.:|:|||..||:|:..||.||..
  Fly   164 NTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEK 228

  Fly   246 AAKAAQEAKQRIDQSECEGGSRGRRGRRA------WLE 277
            ||.|||||:.|..          |..|||      ||:
  Fly   229 AACAAQEARHRAT----------RERRRAELRHLLWLK 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 73/160 (46%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 22/61 (36%)
DUF745 60..223 CDD:283087 74/165 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.