DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG12985

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_573255.1 Gene:CG12985 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster

Alignment Length:208 Identity:64/209 (31%)
Similarity:112/209 (54%) Gaps:13/209 (6%)


  Fly    63 GEDSNSPAKKTRNH-------------TNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKG 114
            |.|.|....|.||:             .|::.:::.||..||..||.|||....|.::|:.:.|.
  Fly    89 GCDRNRDRDKDRNNIRDRDNCDSCDEIINSRLKATHIAQNAAQVAKAANDAQAAAAQDASRQAKM 153

  Fly   115 EYADKANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQE 179
            :.|:||.:||:||:|||.||..:::....|:|:||.||.:.:..|..:|:|.:.:....:..:.:
  Fly   154 QLAEKAISAARAADAVLEGKQAMVDNYAREIRDAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQ 218

  Fly   180 LKTLTISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAAL 244
            .:|....::....|....|.:.......:.:|..:|.||:.|.:.|.||:::|:.:|::.|:||.
  Fly   219 AETFRALVQQTSGILSEMDSLIDQSNMDIEEKNQMLAAAKARGDRLARQVAQAKSEYEQVKEAAC 283

  Fly   245 SAAKAAQEAKQRI 257
            .||.||.||||::
  Fly   284 RAASAAVEAKQKV 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 47/160 (29%)
CG12985NP_573255.1 DUF745 117..296 CDD:283087 58/179 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.