DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14839 and CG33257

DIOPT Version :9

Sequence 1:NP_650351.2 Gene:CG14839 / 41736 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster


Alignment Length:306 Identity:79/306 - (25%)
Similarity:138/306 - (45%) Gaps:49/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIIVLSSLPA---SATGNHYRTRRKPMQTEDSDLMRSFAGGLGGGGPGDGTVCDMSGEDSNSPAK 71
            |:::||:...   ...|.|||.::.|              .:..||..:..:..:...:...|..
  Fly    15 LVLLLSNALGRLHKRNGYHYRPQQPP--------------PIHQGGYFEPHLPAVEPPEPEKPQH 65

  Fly    72 KTRNH-------TNAKQRSSG----------IAVQAANEAKKANDDMKNAVKEAADKIKGEYADK 119
            .|:::       ::...:.||          ||..:|::|..|..:...|.|:||...:...|..
  Fly    66 STKSYYTTSGGSSSVSSKGSGGYSIGSGLRSIAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQA 130

  Fly   120 ANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQELKTLT 184
            |:.||..|:|.|.||..||::||.:..||:..:..|.::|..|:.:|:||.:|.|.....:..||
  Fly   131 ASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLT 195

  Fly   185 ISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAA-- 247
            .::..||.:.:.::|..|.....||.::.::..::.|:..:..||.:||:||..||::||.||  
  Fly   196 AAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANS 260

  Fly   248 ---------KAAQEAKQRIDQSECEGGSRGRRGRRAWLE---YKEH 281
                     ||||.|...:.:| ....:.|..|:....|   |.||
  Fly   261 AAAAQVNASKAAQHATIGLHES-TNPSAHGHDGQELGGEEESYDEH 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 48/169 (28%)
CG33257NP_996107.1 DUF745 94..252 CDD:283087 48/157 (31%)
SNARE 195..240 CDD:304603 8/44 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.