DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14839 and CG33257

Sequence 1:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster

Alignment Length:306 Identity:79/307 (26%)
Similarity:138/307 (45%) Gaps:49/307 (16%)


  Fly    10 LIIVLSSLPA---SATGNHYRTRRKPMQTEDSDLMRSFAGGLGGGGPGDGTVCDMSGEDSNSPAK 71
            |:::||:...   ...|.|||.::.|              .:..||..:..:..:...:...|..
  Fly    15 LVLLLSNALGRLHKRNGYHYRPQQPP--------------PIHQGGYFEPHLPAVEPPEPEKPQH 65

  Fly    72 KTRNH-------TNAKQRSSG----------IAVQAANEAKKANDDMKNAVKEAADKIKGEYADK 119
            .|:::       ::...:.||          ||..:|::|..|..:...|.|:||...:...|..
  Fly    66 STKSYYTTSGGSSSVSSKGSGGYSIGSGLRSIAQGSADQAHSAVTNQHAAAKQAAYIAQNTLAQA 130

  Fly   120 ANAAAKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAKTHQLVQQELKTLT 184
            |:.||..|:|.|.||..||::||.:..||:..:..|.::|..|:.:|:||.:|.|.....:..||
  Fly   131 ASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHISVLT 195

  Fly   185 ISLKLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAA-- 247
            .::..||.:.:.::|..|.....||.::.::..::.|:..:..||.:||:||..||::||.||  
  Fly   196 AAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAATKESALKAANS 260

  Fly   248 ---------KAAQEAKQRIDQSECEGGSRGRRGRRAWLE---YKEH 281
                     ||||.|...:.:| ....:.|..|:....|   |.||
  Fly   261 AAAAQVNASKAAQHATIGLHES-TNPSAHGHDGQELGGEEESYDEH 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14839NP_650351.2 DUF745 77..237 CDD:283087 49/170 (29%)
CG33257NP_996107.1 SNARE 195..240 CDD:304603 9/45 (20%)
DUF745 94..252 CDD:283087 49/158 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.