DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14840 and CG14839

Sequence 1:NP_650349.1 Gene:CG14840 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster

Alignment Length:272 Identity:105/273 (38%)
Similarity:146/273 (53%) Gaps:26/273 (10%)


  Fly     4 TKALLLVLLLLRAFPRLESYHYR----PAETNDKQCLSALYGDASIDGTGGAGGLGGGSEGCGEP 64
            |:.:.|:::|..........|||    |.:|.|...:.:.           |||||||..|.|..
  Fly     5 TQIMWLIIVLSSLPASATGNHYRTRRKPMQTEDSDLMRSF-----------AGGLGGGGPGDGTV 58

  Fly    65 NSKKGVGCSS-GTGVFGRGDPKQKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQS 128
            ....|...:| ........:.||::|.||.:||.|||.|:|....|.:.||.::|.|.|.||..:
  Fly    59 CDMSGEDSNSPAKKTRNHTNAKQRSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAA 123

  Fly   129 ARAAEAALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVI 193
            |:||||.|.||.|::|||:.|:.||:.||.|....|...::||..||. .|:...|  :||.|.|
  Fly   124 AKAAEAVLFGKSQVLEQLEAEVREAEMVVQEENQELITAESNAQLAAK-THQLVQQ--ELKTLTI 185

  Fly   194 AATSNLAN-----IENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAAC 253
            :.  .||.     .:.|.:..||.||:||.|||||:.||..|.||::||:.|::|||:||..||.
  Fly   186 SL--KLAKDIKDASDQVYTVWQQSLADKTALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAK 248

  Fly   254 AAVEAKQKAQRS 265
            ||.||||:..:|
  Fly   249 AAQEAKQRIDQS 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14840NP_650349.1 DUF745 82..262 CDD:283087 84/185 (45%)
CG14839NP_650351.2 DUF745 77..237 CDD:283087 71/165 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.