DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14840 and CG11694

Sequence 1:NP_650349.1 Gene:CG14840 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster

Alignment Length:268 Identity:125/269 (46%)
Similarity:156/269 (58%) Gaps:19/269 (7%)


  Fly     9 LVLLLLRAFPRLESYHYRPAETNDKQCLSALYGDASIDGTGGAGGLGGGSEGCGEPNSKKGVGCS 73
            :..||...|....:.|..|..:|:   ::||..|...||........||:....:.|.|..|   
  Fly     6 IAFLLFFLFSDHSAGHKLPQSSNE---IAALMSDHHGDGDNSVSSSSGGAPCDFKMNGKTRV--- 64

  Fly    74 SGTGVFGRGDPKQKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEAALAG 138
                         |||.||||||:||..|||:|:.|.||||.|||.:||.||..:|:||||||||
  Fly    65 -------------KASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQLADKALAAAKAAEAALAG 116

  Fly   139 KQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNLANIE 203
            ||||||||:.|:.|.:.||.|.::.||.||....||..||.:|..|||.:...|..|..|:.|.|
  Fly   117 KQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQLNTITLAVKNAQDNVVNSE 181

  Fly   204 NVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQKAQRSRRM 268
            :|||||||||.||.||:||||.|||.|.||:..|:.||:.||.||.||||||.||:.:|.|.||.
  Fly   182 HVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQEARHRATRERRR 246

  Fly   269 THRQQVRW 276
            ...:.:.|
  Fly   247 AELRHLLW 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14840NP_650349.1 DUF745 82..262 CDD:283087 104/180 (58%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 29/77 (38%)
DUF745 60..223 CDD:283087 95/179 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.