DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14840 and CG12985

Sequence 1:NP_650349.1 Gene:CG14840 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_573255.1 Gene:CG12985 FlyBaseID:FBgn0030881 Length:370 Species:Drosophila melanogaster

Alignment Length:175 Identity:77/176 (44%)
Similarity:119/176 (68%) Gaps:0/176 (0%)


  Fly    87 KASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEAALAGKQQIVEQLQQEMT 151
            ||::|||.|||.||||:|:|.|||:.|:.|.|.:||.||..:||||:|.|.|||.:|:...:|:.
  Fly   121 KATHIAQNAAQVAKAANDAQAAAAQDASRQAKMQLAEKAISAARAADAVLEGKQAMVDNYAREIR 185

  Fly   152 EADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNLANIENVASGAQQELAEK 216
            :|:.||.:|:.||||::.|..|:.:....|:.|....:.||...:..|:.::::...:..::.||
  Fly   186 DAEEVVGQVSCSLQNSETNVEASCAVVKAAEVQAETFRALVQQTSGILSEMDSLIDQSNMDIEEK 250

  Fly   217 TQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQK 261
            .|:|.|||.|.:.|.||:.:||:::|:.|:||.:||.||||||||
  Fly   251 NQMLAAAKARGDRLARQVAQAKSEYEQVKEAACRAASAAVEAKQK 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14840NP_650349.1 DUF745 82..262 CDD:283087 77/176 (44%)
CG12985NP_573255.1 DUF745 117..296 CDD:283087 77/176 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.