DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9616 and CG9631

DIOPT Version :10

Sequence 1:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:145 Identity:60/145 - (41%)
Similarity:76/145 - (52%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSITLFALLVLCAGPTLG--LLVPQHYCDEHFRYAMKDKQQTYIGIFSAPDEAINSNTVLNWLAT 63
            |:|....||.||....||  |.||||.|:.:|.| .|:....|||:|:||...:||   |:|...
  Fly     1 MTILWLTLLGLCLNLKLGSALHVPQHNCERYFSY-YKEDSGAYIGVFTAPRAGVNS---LSWEVV 61

  Fly    64 FEMQGKRDL-FVGSMNTYPNKNEAAINIVRGMPAEVFVEFLNITNALPKLTSLYLNDQLLCSNEE 127
            |...|..:. .|||:..||||..|...|..|...||||.|.:..|.||||.....|.::||.|||
  Fly    62 FTAHGTGEANTVGSLIPYPNKERAFEKIHSGERGEVFVRFTDFGNELPKLVRAEFNGEVLCQNEE 126

  Fly   128 YPFPKTRITLRHQMT 142
            |..|.:.:|.|..|:
  Fly   127 YDAPSSTMTRRQSMS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9616NP_650347.2 GD_N 24..133 CDD:464985 45/109 (41%)
CG9631NP_650345.1 GD_N 26..132 CDD:464985 45/109 (41%)
Tryp_SPc 198..436 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.