DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9616 and CG30375

DIOPT Version :10

Sequence 1:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:134 Identity:28/134 - (20%)
Similarity:42/134 - (31%) Gaps:54/134 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GKRDLFVGSMNTY------------PNKNEAA---INIV------------RGM--------PAE 97
            |:.||..|:.:.|            |...|.|   ||.:            ||:        .||
  Fly   211 GEHDLSTGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQAE 275

  Fly    98 VFVEFLNI--------------TNALPKLTSLYLNDQLLCSNEEYPFPKTRITLRHQMTIRVKNK 148
            ....:.|:              :|.|.|.|.|.: |..:|.:..    .:.||..|..|.....:
  Fly   276 NSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTM-DNAVCRSRF----NSSITPSHLCTYDAGGR 335

  Fly   149 GKYS 152
            |:.|
  Fly   336 GQDS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9616NP_650347.2 GD_N 24..133 CDD:464985 22/113 (19%)
CG30375NP_724665.1 CUB 38..>100 CDD:412131
Tryp_SPc 152..387 CDD:238113 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.