DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Prss32

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:309 Identity:98/309 - (31%)
Similarity:148/309 - (47%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PSRSNAPQQAV-RSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRES 297
            |:.|::|.... |..:||         ...|||.|  |:..|..|:..|.|:.||.|::.|    
Mouse    24 PTDSDSPSTTTGRRSIDL---------DSVCGRPR--TSGRIVSGQDAQLGRWPWQVSVRE---- 73

  Fly   298 NGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDG----EFRGVSQLII 358
            || |.:|||:||:...||:|||||. .|:.|  |...|.||  |::.:.:.    |.|.|:|.|.
Mouse    74 NG-AHVCGGSLIAEDWVLTAAHCFN-QGQSL--SIYTVLLG--TISSYPEDNEPKELRAVAQFIK 132

  Fly   359 HENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTE 423
            |.::...:.:..|:|||:|..|:.:.||::|:||....:.:|  .|...:|.|||  ..||....
Mouse   133 HPSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLD--PGTMCWVTGWG--HIGTNQPL 193

  Fly   424 VSKVT----DLNIVSEANC-------ALELPHVLVQPSSLCA-----KKTGAGPCASDGGGPLML 472
            ....|    .:.::....|       ::.....::....|||     ||..   |..|.||||:.
Mouse   194 PPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDA---CNGDSGGPLVC 255

  Fly   473 REQDVWVLRGVISGGVINEKENTCELSK-PSVFTDVAKHIEWVRQKMWN 520
            ...|||:..||:|.|      :.|.|.| |.|:|:|:.:|.|::..|||
Mouse   256 DINDVWIQAGVVSWG------SDCALFKRPGVYTNVSVYISWIQNTMWN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 83/260 (32%)
Tryp_SPc 277..514 CDD:214473 82/257 (32%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 83/261 (32%)
Tryp_SPc 54..295 CDD:238113 84/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.