DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG12951

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:115/237 - (48%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 PWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEF 350
            |::|::   |..:| :..|||::||...|::||||  ..||  ||..|::..|...::.......
  Fly    42 PFVVSL---RSYDG-SHSCGGSIISKHFVMTAAHC--TNGR--PADTLSIQFGVTNISAMGPNVV 98

  Fly   351 RGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDY-IVPICLWSTSNRMDLPQ---GLKSYVAG 411
             |:.::|.||:|...:....|::|:.::||..:... :.|:.|.:.:  ..:||   |::..:.|
  Fly    99 -GIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALA--FAVPQSDAGVEGVLIG 160

  Fly   412 WGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLC--AKKTGAGPCASDGGGPLMLRE 474
            ||.::|.....:..:...|.|.|:..|.............:|  ..:.|.|.|:.|.||||:...
  Fly   161 WGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNG 225

  Fly   475 QDVWVLRGVISGGVINEKENTCELSK-PSVFTDVAKHIEWVR 515
            |.|    |::|..:     ..|.::. |.|:..|:::::|::
  Fly   226 QQV----GIVSWSI-----KPCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 60/237 (25%)
Tryp_SPc 277..514 CDD:214473 59/234 (25%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 59/234 (25%)
Tryp_SPc 30..260 CDD:238113 60/237 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.