DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG6592

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:356 Identity:92/356 - (25%)
Similarity:145/356 - (40%) Gaps:78/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 QQANPNRGITSQPEIPSPVPQRPTPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERAS--- 269
            ||..|...::..|..........:|..|..:....|..|..::   .|....|:..|||.::   
  Fly    31 QQVKPMYLVSMYPGPAGLSTSSSSPFSSSGSLEHDAEMSASNV---DNRHIKGLGMGREMSALSE 92

  Fly   270 ------------TTPLIFQGKSLQRGQL----------------PWLVAIFERRESNGPAFICGG 306
                        ||||:  .|.|..|.:                |:.|.:..:|...  .:.|||
  Fly    93 EDDREPLVLNLETTPLM--EKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG--LYWCGG 153

  Fly   307 TLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLII-HENFQF------ 364
            :|||...|::||||.     |: |.|..|.||.|.:   .:.:.:|..:|:: .||||.      
  Fly   154 SLISDKHVITAAHCV-----DM-AKRALVFLGANEI---KNAKEKGQVRLMVPSENFQIYPTWNP 209

  Fly   365 KQFTEADLALVRLDEPVRYTDYIVPICL-------WSTSNRMDLPQGLKSYVAGWGPDETGT-GN 421
            |:..: |:|:|||...|.:.:.|.||.|       .|..|::       :..:|||...||. ..
  Fly   210 KRLKD-DIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKL-------AIASGWGRYATGVHAI 266

  Fly   422 TEVSKVTDLNIVSEANCALELPHVLVQPSSLCAK-KTGAGPCASDGGGPLML--REQDVWVLRGV 483
            :.|.:...|.|:....|....| :..:.:::|.. :.....|..|.||||:|  |.....||.|:
  Fly   267 SNVLRYVQLQIIDGRTCKSNFP-LSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGI 330

  Fly   484 ISGGVINEKENTCELSKPSVFTDVAKHIEWV 514
            .|.|.|    ..|:...|:.||.||.:::|:
  Fly   331 TSFGSI----YGCDRGYPAAFTKVASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 75/272 (28%)
Tryp_SPc 277..514 CDD:214473 74/270 (27%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/258 (28%)
Tryp_SPc 123..359 CDD:238113 72/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.