DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and CG14227

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:300 Identity:70/300 - (23%)
Similarity:116/300 - (38%) Gaps:89/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CGRERASTTPLIF-----QGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHC-F 321
            |||...:...|.:     ....:|..  ||:|::.    .||.| .|.|:||:...||:|||| |
  Fly    31 CGRSLPTNAKLTWWNYFDSSTDIQAN--PWIVSVI----VNGKA-KCSGSLINHRFVLTAAHCVF 88

  Fly   322 RA-------------PGRDLPA-SRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADL 372
            |.             ||::..: :||:     |...:..|       :.|:|..|...|..:.|:
  Fly    89 REAMQVHLGDFDAWNPGQNCSSGARLS-----NAYCVRID-------KKIVHAGFGKIQAQQYDI 141

  Fly   373 ALVRLDEPVRYTDYIVPICL----------------WSTS--NRMDLPQGLKSYVAGWGPDETGT 419
            .|:|:...|:|:|::.||||                |.|:  :...:|:.||..|.         
  Fly   142 GLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVG--------- 197

  Fly   420 GNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRG-- 482
                       :.:....|.|:... .|..|.:|.....:..|..|.|||...:     :|.|  
  Fly   198 -----------DRIDRELCTLKFQQ-QVDESQICVHTETSHACKGDSGGPFSAK-----ILYGGT 245

  Fly   483 --VISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKMWN 520
              ....|:|....::|  :..||.|:|..:::|:...:.|
  Fly   246 YRTFQFGIIIFGLSSC--AGLSVCTNVTFYMDWIWDALVN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/276 (24%)
Tryp_SPc 277..514 CDD:214473 64/273 (23%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/264 (24%)
Tryp_SPc 57..277 CDD:238113 63/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.