DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:262 Identity:75/262 - (28%)
Similarity:116/262 - (44%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG 338
            |..|:....||.|:.:|:.....:.  ..:|||::::.:.:|:||||              |..|
Mosquito    73 ITNGQEATPGQFPYQIALLSNFATG--TGLCGGSVLTNNYILTAAHC--------------VISG 121

  Fly   339 RNTLAIHSDGEFRGVSQLIIHENFQFK-QFTEA---------------DLALVRLDEPVRYTDYI 387
            ..|||. |.....|.....::|..|.: .||.|               |:|:|||:.|:.:|..|
Mosquito   122 ATTLAT-SGTAIMGAHNRNVNEPTQQRIGFTSAGIRAHPGYNPTNIRNDIAVVRLNSPITFTARI 185

  Fly   388 VPICLWSTSNRMDLPQ--GLKSYVAGWGPDETGTGNTE-VSKVTDLNIVSEANCALELPHVLVQP 449
            .||.|   ..|.|..|  |....|:|:| ..|.||.|. |...|...:::.|:|.......|:||
Mosquito   186 QPIRL---PGRSDSRQFGGFTGTVSGFG-RTTNTGATSPVVMFTSNPVMTNADCIARWNTALIQP 246

  Fly   450 SSLCAKKTGA-GPCASDGGGPLMLREQDVWVLR-GVISGGVINEKENTCELSKPSVFTDVAKHIE 512
            .::|....|. ..|..|.||||.:  ||...|: |::|.|    ....|.:..|||:..|:.:::
Mosquito   247 QNVCLSGDGGRSSCNGDSGGPLTV--QDGGSLQIGIVSFG----SAAGCSIGMPSVYARVSFYLD 305

  Fly   513 WV 514
            |:
Mosquito   306 WI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 74/259 (29%)
Tryp_SPc 277..514 CDD:214473 73/257 (28%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 74/260 (28%)
Tryp_SPc 73..310 CDD:238113 75/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.