DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31326 and Tmprss15

DIOPT Version :9

Sequence 1:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:340 Identity:103/340 - (30%)
Similarity:158/340 - (46%) Gaps:56/340 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 GRSNESLPAFQNPGWGTAPQQANPNRGITSQPEIPSPVPQRPTPNPSRSNAPQQAVRSPVDLVPQ 253
            |.:|.|:|.....|.........||..:...|.:               ...|.::     ::.|
  Rat   726 GSANSSMPILSTGGGPFVRLNEAPNGSLILTPSL---------------QCSQDSL-----ILLQ 770

  Fly   254 QNPSSNGIPCGRERAS--TTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLS 316
            .|..|    ||.:..:  ..|.|..|...|.|..||:||:: .|:.:|...:||.:|:|:..::|
  Rat   771 CNHKS----CGEKMVTQKVGPKIVGGSDTQAGAWPWVVALY-YRDRSGDRLLCGASLVSSDWLVS 830

  Fly   317 AAHC-FRAPGRDLPASRLAVSLGRNTLAIHSDGEF-------RGVSQLIIHENFQFKQFTEADLA 373
            |||| :|   |:|..:|....||     :|.....       |.|.:::|:.::. |:....|:|
  Rat   831 AAHCVYR---RNLDPTRWTAVLG-----LHMQSNLTSPQVVRRVVDRIVINPHYD-KRRKVNDIA 886

  Fly   374 LVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNT-EVSKVTDLNIVSEAN 437
            ::.|:..|.|||||.|||| ...|:...| |....:||||.::...|:| :|.|..|:.:||...
  Rat   887 MMHLEFKVNYTDYIQPICL-PEENQTFTP-GRMCSIAGWGYNKINAGSTVDVLKEADVPLVSNEK 949

  Fly   438 CALELPHVLVQPSSLCA--KKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCEL-S 499
            |..:||...:..|.|||  ::.|...|..|.|||||.:|.:.|.|.||.|.||      .|.| :
  Rat   950 CQQQLPEYDITESMLCAGYEEGGTDSCQGDSGGPLMCQENNRWFLVGVTSFGV------QCALPN 1008

  Fly   500 KPSVFTDVAKHIEWV 514
            .|.|:..|::.|||:
  Rat  1009 HPGVYARVSQFIEWI 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 87/250 (35%)
Tryp_SPc 277..514 CDD:214473 86/248 (35%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 88/253 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.